Overview

  • Product name

  • Description

    Rabbit polyclonal to AGXT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat AGXT2 aa 225-512. (Expressed in E.coli).
    Sequence:

    MCPDVFRGPWGGSHCRDSPVQTVRKCSCAPDGCQAKERYIEQFKDTLNTS VATSIAGFFAEPIQGVNGVVQYPKEFLKEAFALVRERGGVCIADEVQTGF GRLGSHFWGFQTHDTMPDIVTMAKGIGNGFPMAAVVTTPEIASSLAKHLH HFSTFGGSPLACAIGSAVLEVIEEENLQRNSQEVGTYMLLKFAKLRDEFD IVGDVRGKGLMVGIEMVQDKISRQPLPKTEVNQIHEDCKDMGLLVGRGGN FSQTFRIAPPMRVTKLEVDFAFEVFRSALTQHMERRAK


    Database link: Q64565

  • Positive control

    • IHC-P: Rat kidney, stomach and heart tissues. WB: Recombinant rat AGXT2 protein; Rat liver and kidney lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232914 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232914 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 57 kDa.

Target

  • Relevance

    AGXT2 is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor.
  • Cellular localization

    Mitochondrial
  • Database links

  • Alternative names

    • (R)-3-amino-2-methylpropionate--pyruvate transaminase antibody
    • AGT2 antibody
    • AI303810 antibody
    • AI663818 antibody
    • Alanine glyoxylate aminotransferase 2 antibody
    • Alanine glyoxylate aminotransferase 2 mitochondrial antibody
    • Beta-ALAAT II antibody
    • Beta-alanine-pyruvate aminotransferase antibody
    • DAIBAT antibody
    see all

Images

  • All lanes : Anti-AGXT2 antibody (ab232914) at 1 µg/ml

    Lane 1 : Rat liver lysate
    Lane 2 : Rat kidney lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 57 kDa

  • Anti-AGXT2 antibody (ab232914) at 1 µg/ml + Recombinant rat AGXT2 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 57 kDa

  • Paraffin-embedded rat heart tissue stained for AGXT2 using ab232914 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat stomach tissue stained for AGXT2 using ab232914 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat kidney tissue stained for AGXT2 using ab232914 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat kidney tissue stained for AGXT2 using ab232914 at 20 µg/ml in immunohistochemical analysis. DAB staining.

References

ab232914 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232914.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up