Overview

  • Product name

    Anti-AGXT2 antibody - C-terminal
    See all AGXT2 primary antibodies
  • Description

    Rabbit polyclonal to AGXT2 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human AGXT2 aa 430-514 (C terminal).
    Sequence:

    DVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQ TFRIAPSMCITKPEVDFAVEVFRSALTQHMERRAK


    Database link: Q9BYV1

  • Positive control

    • IHC-P: human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224537 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    AGXT2 is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor.
  • Cellular localization

    Mitochondrial
  • Database links

  • Alternative names

    • (R)-3-amino-2-methylpropionate--pyruvate transaminase antibody
    • AGT2 antibody
    • AI303810 antibody
    • AI663818 antibody
    • Alanine glyoxylate aminotransferase 2 antibody
    • Alanine glyoxylate aminotransferase 2 mitochondrial antibody
    • Beta-ALAAT II antibody
    • Beta-alanine-pyruvate aminotransferase antibody
    • DAIBAT antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for AGXT2 using ab224537 at 1/50 dilution in immunohistochemical analysis.

References

ab224537 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224537.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up