Overview

  • Product name

  • Description

    Rabbit polyclonal to AH2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human AH2 aa 370-624.
    Sequence:

    GSVSSSERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYW DPGHIKQAEDRAHRIGQCSSVNIHYLIANGTLDTLMWGMLNRKAQVTGST LNGRKEKIQAEEGDKEKWDFLQFAEAWTPNDSSEELRKEALFTHFEKEKQ HDIRSFFVPQPKKRQLMTSCDESKRFREENTVVSSDPTKTAARDIIDYES DVEPETKRLKLAASEDHCSPSEETPSQSKQIRTPLVESVQEAKAQLTTPA FPVEG


    Database link: Q5FWF4

  • Positive control

    • IHC-P: Human adrenal gland tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab223032 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Sequence similarities

    Belongs to the SNF2/RAD54 helicase family.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
    Contains 1 RanBP2-type zinc finger.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4933425L19Rik antibody
    • AH2 antibody
    • Annealing helicase 2 antibody
    • DNA annealing helicase and endonuclease ZRANB3 antibody
    • MGC105033 antibody
    • MGC75012 antibody
    • OTTHUMP00000197449 antibody
    • Zinc finger Ran-binding domain-containing protein 3 antibody
    • Zinc finger, RAN- binding domain containing 3 antibody
    • ZRAB3_HUMAN antibody
    • Zranb3 antibody
    see all

Images

  • Paraffin-embedded human adrenal gland tissue stained for AH2 using ab223032 at 1/100 dilution in immunohistochemical analysis.

References

ab223032 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223032.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up