Overview

  • Product name

  • Description

    Rabbit polyclonal to AHNAK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human AHNAK aa 4990-5113.
    Sequence:

    DIKSPSLDVTVPEAELNLETPEISVGGKGKKSKFKMPKIHMSGPKIKAKK QGFDLNVPGGEIDASLKAPDVDVNIAGPDAALKVDVKSPKTKKTMFGKMY FPDVEFDIKSPKFKAEAPLPSPKL


    Database link: Q09666

  • Positive control

    • ICC/IF: A431 cells. IHC-P: Human rectum tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab223709 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/permeabilization: PFA/Triton X100

Target

  • Function

    May be required for neuronal cell differentiation.
  • Sequence similarities

    Contains 1 PDZ (DHR) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • AHNAK antibody
    • AHNAK nucleoprotein (desmoyokin) antibody
    • AHNAK nucleoprotein antibody
    • AHNAKRS antibody
    • AHNK_HUMAN antibody
    • Desmoyokin antibody
    • Fragments antibody
    • MGC5395 antibody
    • Neuroblast differentiation associated protein AHNAK antibody
    • Neuroblast differentiation-associated protein AHNAK antibody
    • PM227 antibody
    see all

Images

  • Paraffin embedded sections of human rectum tissue were stained for AHNAK with ab223709 at 1/500 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for AHNAK (green) using ab223709 at 4 µg/ml in ICC/IF.

References

ab223709 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223709.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up