Overview

  • Product name

  • Description

    Rabbit polyclonal to AHNAK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human AHNAK aa 5583-5716.
    Sequence:

    LGEGHLSVKGSGGEWKGPQVSSALNLDTSKFAGGLHFSGPKVEGGVKGGQ IGLQAPGLSVSGPQGHLESGSGKVTFPKMKIPKFTFSGRELVGREMGVDV HFPKAEASIQAGAGDGEWEESEVKLKKSKIKMPK


    Database link: Q09666

  • Positive control

    • IHC-P: Human oral mucosa tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223762 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May be required for neuronal cell differentiation.
  • Sequence similarities

    Contains 1 PDZ (DHR) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • AHNAK antibody
    • AHNAK nucleoprotein (desmoyokin) antibody
    • AHNAK nucleoprotein antibody
    • AHNAKRS antibody
    • AHNK_HUMAN antibody
    • Desmoyokin antibody
    • Fragments antibody
    • MGC5395 antibody
    • Neuroblast differentiation associated protein AHNAK antibody
    • Neuroblast differentiation-associated protein AHNAK antibody
    • PM227 antibody
    see all

Images

  • Paraffin-embedded human oral mucosa tissue stained for AHNAK using ab223762 at 1/20 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for AHNAK (green) using ab223762 at 4 µg/ml in ICC/IF.

References

ab223762 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223762.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up