Overview

  • Product name

  • Description

    Rabbit polyclonal to AHNAK2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human AHNAK2 aa 2643-2748.
    Sequence:

    DAKDSKFKMPKFKMPSFRVSAPGESIEALVDVSELKVEADMSLPSMQGDL KTTDISIQPPSAQLEVQAGQVDVKLPEGHVPEGAGLKGHLPKLQMPSFKM PEVDLKG


    Database link: Q8IVF2

  • Positive control

    • IHC-P: Human skin. ICC/IF: U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224055 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    AHNAK2 contains 1 PDZ (DHR) domain. There are 3 named isoforms of AHNAK2 produced by alternative splicing. AHNAK2 is a 600-kDa protein composed of a large number of highly conserved repeat segments. AHNAKs are a class of giant propeller-like proteins that associate with calcium channel proteins of cardiomyocytes and other cells.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • AHNAK 2 antibody
    • AHNAK nucleoprotein 2 antibody
    • C14orf78 antibody
    • chromosome 14 open reading frame 78 antibody
    • KIAA2019 antibody
    see all

Images

  • Paraffin embedded human skin tissue stained for AHNAK2 with ab224055 (1/200 dilution) in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for AHNAK2 (green) using ab224055 (4 µg/ml) in ICC/IF.

References

ab224055 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224055.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up