Anti-Ahsp antibody (ab231040)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Ahsp antibody
See all Ahsp primary antibodies -
Description
Rabbit polyclonal to Ahsp -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat -
Immunogen
Recombinant full length protein corresponding to Rat Ahsp aa 2-102. (N-terminal His-tag and GST-tag. Expressed in E.coli).
Sequence:APFQSNKDLISTGIKEFNVLLDQQVFDDPLMPEEDMKTVVNDWVNLYINY YKKHVLGEQQEQDGALKELQQELSTLGSQFLAKYRIILKSKETPSSKPPS S
Database link: A9UMW3 -
Positive control
- WB: Recombinant rat Ahsp protein. Rat and mouse liver lysates. IHC-P: Rat stomach, liver and kidney tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab231040 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231040 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 12 kDa. | |
| IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Act as a chaperone to prevent the harmful aggregation of alpha-hemoglobin during normal erythroid cell development. Specifically protects free alpha-hemoglobin from precipitation. It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia. -
Tissue specificity
Expressed in blood and bone marrow. -
Sequence similarities
Belongs to the AHSP family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 170812 Mouse
- Entrez Gene: 293522 Rat
- SwissProt: Q9CY02 Mouse
- Unigene: 423023 Mouse
-
Alternative names
- AHSP antibody
- AHSP_HUMAN antibody
- Alpha hemoglobin stabilizing protein antibody
see all
Images
-
Western blot - Anti-Ahsp antibody (ab231040)All lanes : Anti-Ahsp antibody (ab231040) at 3 µg/ml
Lane 1 : Rat liver lysate
Lane 2 : Mouse liver lysate
Secondary
All lanes : HRP-linked Guinea pig Anti-Rabbit IgG at 1/2000 dilution
Predicted band size: 12 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Ahsp antibody (ab231040)Paraffin-embedded rat stomach tissue stained for Ahsp with ab231040 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Western blot - Anti-Ahsp antibody (ab231040)Anti-Ahsp antibody (ab231040) at 3 µg/ml + Recombinant rat Ahsp protein
Secondary
HRP-Linked Guinea pig Anti-Rabbit antibody at 1/2000 dilution
Predicted band size: 12 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Ahsp antibody (ab231040)Paraffin-embedded rat kidney tissue stained for Ahsp with ab231040 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Ahsp antibody (ab231040)Paraffin-embedded rat liver tissue stained for Ahsp with ab231040 at 10 µg/ml in immunohistochemical analysis. DAB staining.
Datasheets and documents
References
ab231040 has not yet been referenced specifically in any publications.
