Anti-Ahsp antibody (ab231040)
Key features and details
- Rabbit polyclonal to Ahsp
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Rat
- Isotype: IgG
Overview
-
Product name
Anti-Ahsp antibody
See all Ahsp primary antibodies -
Description
Rabbit polyclonal to Ahsp -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat -
Immunogen
Recombinant full length protein corresponding to Rat Ahsp aa 2-102. (N-terminal His-tag and GST-tag. Expressed in E.coli).
Sequence:APFQSNKDLISTGIKEFNVLLDQQVFDDPLMPEEDMKTVVNDWVNLYINY YKKHVLGEQQEQDGALKELQQELSTLGSQFLAKYRIILKSKETPSSKPPS S
Database link: A9UMW3 -
Positive control
- WB: Recombinant rat Ahsp protein. Rat and mouse liver lysates. IHC-P: Rat stomach, liver and kidney tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab231040 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231040 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 12 kDa. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Act as a chaperone to prevent the harmful aggregation of alpha-hemoglobin during normal erythroid cell development. Specifically protects free alpha-hemoglobin from precipitation. It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia. -
Tissue specificity
Expressed in blood and bone marrow. -
Sequence similarities
Belongs to the AHSP family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 170812 Mouse
- Entrez Gene: 293522 Rat
- SwissProt: Q9CY02 Mouse
- Unigene: 423023 Mouse
-
Alternative names
- AHSP antibody
- AHSP_HUMAN antibody
- Alpha hemoglobin stabilizing protein antibody
see all
Images
-
All lanes : Anti-Ahsp antibody (ab231040) at 3 µg/ml
Lane 1 : Rat liver lysate
Lane 2 : Mouse liver lysate
Secondary
All lanes : HRP-linked Guinea pig Anti-Rabbit IgG at 1/2000 dilution
Predicted band size: 12 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Ahsp antibody (ab231040)
Paraffin-embedded rat stomach tissue stained for Ahsp with ab231040 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Anti-Ahsp antibody (ab231040) at 3 µg/ml + Recombinant rat Ahsp protein
Secondary
HRP-Linked Guinea pig Anti-Rabbit antibody at 1/2000 dilution
Predicted band size: 12 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Ahsp antibody (ab231040)
Paraffin-embedded rat kidney tissue stained for Ahsp with ab231040 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Ahsp antibody (ab231040)
Paraffin-embedded rat liver tissue stained for Ahsp with ab231040 at 10 µg/ml in immunohistochemical analysis. DAB staining.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231040 has not yet been referenced specifically in any publications.