Overview

  • Product name

  • Description

    Rabbit polyclonal to Ahsp
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Ahsp aa 1-102. N-terminal His-tag and S-tag. Expressed in E.coli.
    Sequence:

    MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYIN YYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPP SS


    Database link: Q9NZD4

  • Positive control

    • WB: Recombinant human Ahsp protein; Human and rat liver lysate. IHC-P: Human liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231579 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 12 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Act as a chaperone to prevent the harmful aggregation of alpha-hemoglobin during normal erythroid cell development. Specifically protects free alpha-hemoglobin from precipitation. It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia.
  • Tissue specificity

    Expressed in blood and bone marrow.
  • Sequence similarities

    Belongs to the AHSP family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • AHSP antibody
    • AHSP_HUMAN antibody
    • Alpha hemoglobin stabilizing protein antibody
    • Alpha-hemoglobin-stabilizing protein antibody
    • EDRF antibody
    • ERAF antibody
    • Erythroid associated factor antibody
    • Erythroid differentiation associated factor antibody
    • Erythroid differentiation related factor antibody
    • Erythroid differentiation-related factor antibody
    • Erythroid-associated factor antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Ahsp using ab231579 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Ahsp antibody (ab231579) at 1 µg/ml + Rat liver lysate

    Predicted band size: 12 kDa

  • Anti-Ahsp antibody (ab231579) at 2 µg/ml + Human liver lysate

    Predicted band size: 12 kDa

  • Anti-Ahsp antibody (ab231579) at 2 µg/ml + Recombinant human Ahsp protein

    Predicted band size: 12 kDa

References

ab231579 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231579.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up