Overview

  • Product name

  • Description

    Rabbit polyclonal to AIM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human AIM1 aa 720-805.
    Sequence:

    ARMPNSPAPHFAMPPIHEDHLEKVFDPKVFTFGLGKKKESQPEMSPALHL MQNLDTKSKLRPKRASAEQSVLFKSLHTNTNGNSEP


    Database link: Q9Y4K1

  • Positive control

    • Human esophagus tissue; A431 cells

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab204846 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    May function as suppressor of malignant melanoma. It may exert its effects through interactions with the cytoskeleton.
  • Sequence similarities

    Belongs to the beta/gamma-crystallin family.
    Contains 12 beta/gamma crystallin 'Greek key' domains.
    Contains 1 ricin B-type lectin domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Absent in melanoma 1 antibody
    • Absent in melanoma 1 protein antibody
    • AIM1 antibody
    • AIM1_HUMAN antibody
    • Beta/gamma crystallin domain-containing protein 1 antibody
    • CRYBG1 antibody
    • ST4 antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human esophagus tissue labeling AIM1 with ab204846 at 1/200 dilution.

  • Immunofluorescent analysis of PFA/Triton X-100 fixed and permeabilized A-431 cells labeling AIM1 with ab204846 at 4 µg/ml. Antibody staining is shown in green.

References

ab204846 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204846.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up