Overview

  • Product name

    Anti-AIM2 antibody [7G12D1]
    See all AIM2 primary antibodies
  • Description

    Mouse monoclonal [7G12D1] to AIM2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human AIM2 aa 1-195. (Expressed in E.coli).
    Sequence:

    MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVAT LMIQNAGAVSAVMKTIRIFQKLNYMLLAKRLQEEKEKVDKQYKSVTKPKP LSQAEMSPAASAAIRNDVAKQRAAPKVSPHVKPEQKQMVAQQESIREGFQ KRCLPVMVLKAKKPFTFETQEGKQEMFHATVATEKEFFFVKVFNT


    Database link: O14862

  • Positive control

    • WB: Recombinant human AIM2 (AA: 1-195); HepG2, A549 and AIM2 (AA: 1-195)-hIgGFc transfected HEK-293T whole cell lysate. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab233756 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
ICC/IF 1/200 - 1/1000.

Target

  • Function

    Tumor suppressor which may act by repressing NF-kappa-B transcriptional activity.
  • Tissue specificity

    Expressed in spleen, small intestine, peripheral blood leukocytes, and testis.
  • Sequence similarities

    Belongs to the HIN-200 family.
    Contains 1 DAPIN domain.
    Contains 1 HIN-200 domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Absent in melanoma 2 antibody
    • AIM 2 antibody
    • Aim2 antibody
    • AIM2_HUMAN antibody
    • Interferon-inducible protein AIM2 antibody
    • OTTHUMP00000035296 antibody
    • PYHIN4 antibody
    see all

Images

  • Anti-AIM2 antibody [7G12D1] (ab233756) at 1/500 dilution + Recombinant human AIM2 (AA: 1-195) protein

    Developed using the ECL technique.


    Expected MW is 48.2 kDa.

  • All lanes : Anti-AIM2 antibody [7G12D1] (ab233756) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : AIM2 (AA: 1-195)-hIgGFc transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Developed using the ECL technique.
  • All lanes : Anti-AIM2 antibody [7G12D1] (ab233756) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate

    Developed using the ECL technique.
  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for AIM2 (green) using ab233756 at 1/200 dilution in ICC/IF.

    Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.

References

ab233756 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233756.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up