Overview

  • Product name

  • Description

    Rabbit polyclonal to AIM2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Rat
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human AIM2 aa 1-343. (Expressed in E.coli).
    Sequence:

    MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVAT LMIQNAGAVSAVMKTIRIFQKLNYMLLAKRLQEEKEKVDKQYKSVTKPKP LSQAEMSPAASAAIRNDVAKQRAAPKVSPHVKPEQKQMVAQQESIREGFQ KRCLPVMVLKAKKPFTFETQEGKQEMFHATVATEKEFFFVKVFNTLLKDK FIPKRIIIIARYYRHSGFLENSASRVLDAESDQKVNVPLNIIRKAGETPK INTLQTQPLGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGVRNEDT MKCKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIKVIKAKKKT


    Database link: O14862

  • Positive control

    • WB: HeLa and A549 cell lysate; Pig heart lysate; Recombinant human AIM2 protein. IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233033 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Tumor suppressor which may act by repressing NF-kappa-B transcriptional activity.
  • Tissue specificity

    Expressed in spleen, small intestine, peripheral blood leukocytes, and testis.
  • Sequence similarities

    Belongs to the HIN-200 family.
    Contains 1 DAPIN domain.
    Contains 1 HIN-200 domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Absent in melanoma 2 antibody
    • AIM 2 antibody
    • Aim2 antibody
    • AIM2_HUMAN antibody
    • Interferon-inducible protein AIM2 antibody
    • OTTHUMP00000035296 antibody
    • PYHIN4 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human testis tissue stained for AIM2 using ab233033 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-AIM2 antibody (ab233033) at 1 µg/ml + Pig heart lysate
  • Anti-AIM2 antibody (ab233033) at 1 µg/ml + A549 (human lung carcinoma cell line) cell lysate
  • Anti-AIM2 antibody (ab233033) at 1 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
  • Anti-AIM2 antibody (ab233033) at 1 µg/ml + Recombinant human AIM2 protein

References

ab233033 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233033.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up