Overview

  • Product name

  • Description

    Rabbit polyclonal to AJAP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human AJAP1 aa 308-394.
    Sequence:

    AQSGNTRRNSHQRKTNQQEESCQNLTDFPSARVPSSLDIFTAYNETLQCS HECVRASVPVYTDETLHSTTGEYKSTFNGNRPSSSDR


    Database link: Q9UKB5

  • Positive control

    • WB: Mouse brain and skeletal muscle lysates. IHC-P: Human colon cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab223117 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 45 kDa (predicted molecular weight: 45 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    Plays a role in cell adhesion and cell migration.
  • Tissue specificity

    Expressed in uterus and pancreas (at protein level).
  • Post-translational
    modifications

    Thr-237 and Ser-239 may be phosphorylated; however as this position is probably extracellular, the in vivo relevance is not proven.
  • Cellular localization

    Basolateral cell membrane. Apical cell membrane. Cell junction > adherens junction. Mainly basolateral. Localization is mediated by AP1M2.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adherens junction-associated protein 1 antibody
    • Ajap1 antibody
    • AJAP1_HUMAN antibody
    • Membrane protein shrew-1 antibody
    • MOT8 antibody
    • SHREW-1 antibody
    • SHREW1 antibody
    • Transmembrane protein SHREW1 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for AJAP1 using ab223117 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-AJAP1 antibody (ab223117) at 1/500 dilution

    Lane 1 : Mouse brain lysate
    Lane 2 : Mouse skeletal muscle lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 45 kDa
    Observed band size: 45 kDa

References

This product has been referenced in:

  • Qu W  et al. MiR-552 promotes the proliferation, migration and EMT of hepatocellular carcinoma cells by inhibiting AJAP1 expression. J Cell Mol Med N/A:N/A (2018). Read more (PubMed: 30597727) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223117.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up