Overview

  • Product name

  • Description

    Rabbit polyclonal to AK3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human AK3 aa 8-227. N-terminal tag. Expressed in E. coli.
    Sequence:

    LRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAK AFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQ IDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEP LIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPY VYAFLQTKVPQRSQKASVTP


    Database link: Q9UIJ7-1

  • Positive control

    • IHC-P: Human kidney, colorectal cancer and cerebrum tissue. WB: Recombinant human AK3 protein. Pig kidney, liver and heart tissue lysate. HepG2 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab232888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

Images

  • All lanes : Anti-AK3 antibody (ab232888) at 2 µg/ml

    Lane 1 : HepG2 (Human liver hepatocellular carcinoma cell line) cell lysate
    Lane 2 : Pig heart tissue lysate
    Lane 3 : Pig kidney tissue lysate
    Lane 4 : Pig liver tissue lysate

    Secondary
    All lanes : HRP-linked Guinea pig anti-Rabbit at 1/1000 dilution
  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for AK3 with ab232888 at 30 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for AK3 with ab232888 at 30 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for AK3 with ab232888 at 30 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-AK3 antibody (ab232888) at 2 µg/ml + Recombinant human AK3 protein
  • Formalin-fixed, paraffin-embedded human liver tissue stained for AK3 with ab232888 at 30 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

References

ab232888 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up