Anti-AK5 antibody [OTI1D6] (ab117927)
Key features and details
- Mouse monoclonal [OTI1D6] to AK5
- Suitable for: WB, ICC/IF, Flow Cyt
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-AK5 antibody [OTI1D6]
See all AK5 primary antibodies -
Description
Mouse monoclonal [OTI1D6] to AK5 -
Host species
Mouse -
Tested applications
Suitable for: WB, ICC/IF, Flow Cytmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human AK5 aa 1-562. NP_777283. Produced in HEK-293T cells.
Sequence:MNTNDAKEYLARREIPQLFESLLNGLMCSKPEDPVEYLESCLQKVKELGG CDKVKWDTFVSQEKKTLPPLNGGQSRRSFLRNVMPENSNFPYRRYDRLPP IHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSL KIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTIT EIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPDLVVFLACANQRL KERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDA DRDEDEVFYDISMAVDNKLFPNKEAAAGSSDLDPSMILDTGEIIDTGSDY EDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKY GFTHLSTGELLREELASESERSKLIRDIMERGDLVPSGIVLELLKEAMVA SLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQR SRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAEGTPEDV FLQLCTAIDSIF
Database link: Q9Y6K8 -
Positive control
- WB: HEK-293T cells transfected with pCMV6-ENTRY AK5 cDNA. ICC/IF: COS-7 transiently transfected by pCMV6-ENTRY AK5 cDNA. Flow Cyt: HEK-293T cells transfected with AK5 (Myc-DDK-tagged)-Human adenylate kinase 5 (AK5), transcript variant 1.
-
General notes
Clone OTI1D6 (formerly 1D6).
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography. -
Clonality
Monoclonal -
Clone number
OTI1D6 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab117927 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/2000. Predicted molecular weight: 63 kDa. | |
ICC/IF | 1/100. | |
Flow Cyt | Use at an assay dependent concentration. |
Target
-
Function
Active on AMP and dAMP with ATP as a donor. When GTP is used as phosphate donor, the enzyme phosphorylates AMP, CMP, and to a small extent dCMP. -
Tissue specificity
Brain specific. -
Sequence similarities
Belongs to the adenylate kinase family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 26289 Human
- Omim: 608009 Human
- SwissProt: Q9Y6K8 Human
- Unigene: 559718 Human
- Unigene: 597002 Human
-
Alternative names
- Adenylate kinase 5 antibody
- Adenylate kinase 6 antibody
- Adenylate kinase isoenzyme 5 antibody
see all
Images
-
All lanes : Anti-AK5 antibody [OTI1D6] (ab117927) at 1/2000 dilution
Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with pCMV6-ENTRY control
Lane 2 : HEK-293T cells transfected with pCMV6-ENTRY AK5 cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 63 kDa -
pCMV6-ENTRY AK5 cDNA transfected COS-7 (African green monkey kidney fibroblast-like cell line) cells stained for AK5 using ab117927 at a 1/100 dilution in ICC/IF.
-
Flow Cytometry analysis of HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with AK5 (Myc-DDK-tagged)-Human adenylate kinase 5 (AK5), transcript variant 1, using ab117927 (red) compared to an empty vector control plasmid (blue).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab117927 has not yet been referenced specifically in any publications.