Anti-AKAP associated Sperm Protein/ROPN1L antibody - N-terminal (ab204393)

Overview

  • Product name

    Anti-AKAP associated Sperm Protein/ROPN1L antibody - N-terminal
    See all AKAP associated Sperm Protein/ROPN1L primary antibodies
  • Description

    Rabbit polyclonal to AKAP associated Sperm Protein/ROPN1L - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human AKAP associated Sperm Protein/ROPN1L aa 4-79 (N terminal).
    Sequence:

    PDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLRWSAGYFSALSRGD PLPVKDRMEMPTATQKTDTGLTQGLL


    Database link: Q96C74

  • Positive control

    • IHC-P: Human testis and fallopian tube tissue WB: LY410431 cell lysate.
  • General notes

     This product was previously labelled as AKAP associated Sperm Protein

     

Properties

Applications

Our Abpromise guarantee covers the use of ab204393 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 26 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • All lanes : Anti-AKAP associated Sperm Protein/ROPN1L antibody - N-terminal (ab204393) at 1/100 dilution

    Lane 1 : Negative control
    Lane 2 : LY410431 cell lysate

    Predicted band size: 26 kDa

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue labeling AKAP associated Sperm Protein/ROPN1L with ab204393 at 1/200 dilution. 

  • Immunohistochemical analysis of paraffin-embedded human liver tissue labeling AKAP associated Sperm Protein/ROPN1L with ab204393 at 1/200 dilution. 

  • Immunohistochemical analysis of paraffin-embedded Human fallopian tube tissue labeling AKAP associated Sperm Protein/ROPN1L with ab204393 at 1/200 dilution. 

  • Immunohistochemical analysis of paraffin-embedded Human cerebral cortex tissue labeling AKAP associated Sperm Protein/ROPN1L with ab204393 at 1/200 dilution. 

  • Immunohistochemical analysis of paraffin-embedded Human prostate tissue labeling AKAP associated Sperm Protein/ROPN1L with ab204393 at 1/200 dilution. 

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue labeling AKAP associated Sperm Protein/ROPN1L with ab204393 at 1/200 dilution. 

References

ab204393 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Mouse testis)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: citrate-based buffer, pH6
Permeabilization
No
Specification
Mouse testis
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 0.5% · Temperature: 20°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Feb 28 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up