Overview

  • Product name

    Anti-AKAP12 antibody - C-terminal
    See all AKAP12 primary antibodies
  • Description

    Rabbit polyclonal to AKAP12 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human AKAP12 aa 1631-1777 (C terminal).
    Sequence:

    SKDMSEASEKTMTVEVEGSTVNDQQLEEVVLPSEEEGGGAGTKSVPEDDG HALLAERIEKSLVEPKEDEKGDDVDDPENQNSALADTDASGGLTKESPDT NGPKQKEKEDAQEVELQEGKVHSESDKAITPQAQEELQKQERESAKS


    Database link: Q02952

  • Positive control

    • Human testis tissue, U-251 MG cell line

Properties

Applications

Our Abpromise guarantee covers the use of ab204559 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Anchoring protein that mediates the subcellular compartmentation of protein kinase A (PKA) and protein kinase C (PKC).
  • Tissue specificity

    Expressed in endothelial cells, cultured fibroblasts and osteosarcoma, but not in platelets, leukocytes, monocytic cell lines or peripherical blood cells.
  • Sequence similarities

    Contains 3 AKAP domains.
  • Domain

    Polybasic regions located between residues 266 and 557 are involved in binding PKC.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm > cell cortex. Cytoplasm > cytoskeleton. May be part of the cortical cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • A kinase (PRKA) anchor protein (gravin) 12 antibody
    • A kinase Anchor Protein 12 antibody
    • A kinase anchor protein 250kDa antibody
    • A-kinase anchor protein 12 antibody
    • A-kinase anchor protein 250 kDa antibody
    • AKA12_HUMAN antibody
    • AKAP 12 antibody
    • AKAP 250 antibody
    • AKAP-12 antibody
    • Akap12 antibody
    • AKAP250 antibody
    • DKFZp686M0430 antibody
    • DKFZp686O0331 antibody
    • FLJ20945 antibody
    • FLJ97621 antibody
    • Gercelin antibody
    • Gravin antibody
    • Kinase scaffold protein gravin antibody
    • Myasthenia gravis autoantigen antibody
    • Myasthenia gravis autoantigen gravin antibody
    • OTTHUMP00000017426 antibody
    • OTTHUMP00000017427 antibody
    • Src-Suppressed C Kinase Substrate antibody
    • Srcs5 antibody
    • SSeCKS antibody
    • Tsga12 antibody
    see all

Images

  • Immunofluorescence analysis of U-251 MG cells labeling AKAP12 with ab204559 at 4 µg/ml.

    Fixation/Permeabilization: PFA/Triton X-100

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue labeling AKAP12 with ab204559 at 1/500 dilution.

References

ab204559 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204559.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up