Overview

  • Product name

  • Description

    Rabbit polyclonal to AKAP4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human AKAP4 aa 547-691.
    Sequence:

    SALKLIQYHLTQQTKGKDTCEEDCPGSTMGYMAQSTQYEKCGGGQSAKAL SVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCE DPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQ


    Database link: Q5JQC9

  • Positive control

    • IHC-P: Human testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224065 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Major structural component of sperm fibrous sheath. Plays a role in sperm motility.
  • Tissue specificity

    Testis specific; only expressed in round spermatids.
  • Sequence similarities

    Belongs to the AKAP110 family.
  • Developmental stage

    Post-meiotic phase of spermatogenesis.
  • Domain

    RI-alpha binding site, predicted to form an amphipathic helix, could participate in protein-protein interactions with a complementary surface on the R-subunit dimer.
  • Cellular localization

    Cell projection > cilium > flagellum. Localizes to the principle piece of the sperm flagellum.
  • Information by UniProt
  • Database links

  • Alternative names

    • A kinase (PRKA) anchor protein 4 antibody
    • A kinase anchor protein 4 antibody
    • A kinase anchor protein 82 kDa antibody
    • A-kinase anchor protein 4 antibody
    • A-kinase anchor protein 82 kDa antibody
    • AKAP 4 antibody
    • AKAP 82 antibody
    • AKAP-4 antibody
    • AKAP4 antibody
    • AKAP4_HUMAN antibody
    • AKAP82 antibody
    • FSC 1 antibody
    • FSC1 antibody
    • hAKAP 82 antibody
    • hAKAP82 antibody
    • HI antibody
    • Major sperm fibrous sheath protein antibody
    • p82 antibody
    • PRKA 4 antibody
    • PRKA4 antibody
    • Protein kinase A anchoring protein 4 antibody
    • Protein kinase A-anchoring protein 4 antibody
    • Testis specific gene HI antibody
    see all

Images

  • Paraffin embedded human testis tissue stained for AKAP4 with ab224065 (1/1000 dilution) in immunohistochemical analysis.

References

ab224065 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224065.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up