Overview

  • Product name

    Anti-AKAP7 antibody [OTI6F7]
    See all AKAP7 primary antibodies
  • Description

    Mouse monoclonal [OTI6F7] to AKAP7
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human AKAP7 aa 1-348. Produced in E. coli. NP_057461
    Sequence:

    MERPEAGGINSNECENVSRKKKMSEEFEANTMDSLVDMPFATVDIQDDCG ITDEPQINLKRSQENEWVKSDQVKKRKKKRKDYQPNYFLSIPITNKEIIK GIKILQNAIIQQDERLAKAMVSDGSFHITLLVMQLLNEDEVNIGIDALLE LKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGDHVNSLLEIAETAN RTFQEKGILVGESRSFKPHLTFMKLSKSPWLRKNGVKKIDPDLYEKFISH RFGEEILYRIDLCSMLKKKQSNGYYHCESSIVIGEKNGGEPDDAELVRLS KRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK


    Database link: Q9P0M2

  • Positive control

    • IHC-P: Human tonsil tissue. WB: pCMV6-ENTRY AKAP7 transfected HEK-293T cell lysate.
  • General notes

    Clone OTI6F7 (formerly 6F7).

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI6F7
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236372 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 11 kDa.
IHC-P 1/150. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Target

  • Function

    Targets the cAMP-dependent protein kinase (PKA) to the plasma membrane, and permits functional coupling to the L-type calcium channel.
  • Tissue specificity

    Expressed in brain, heart, lung, pancreas and skeletal muscle.
  • Cellular localization

    Apical cell membrane. Targeted predominantly to the apical membrane and Lateral cell membrane. Targeted predominantly to the lateral membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • A kinase (PRKA) anchor protein 7 antibody
    • A kinase anchor protein 18 kD antibody
    • A kinase anchor protein 7 antibody
    • A kinase anchor protein 7 isoform alpha antibody
    • A kinase anchor protein 7 isoform beta antibody
    • A kinase anchor protein 7 isoform gamma antibody
    • A kinase anchor protein 7 isoforms alpha and beta antibody
    • A kinase anchor protein 9 kDa antibody
    • A kinase anchoring protein 18 antibody
    • A-kinase anchor protein 18 kDa antibody
    • A-kinase anchor protein 7 isoforms alpha and beta antibody
    • AKA7A_HUMAN antibody
    • AKAP 18 antibody
    • AKAP 7 antibody
    • AKAP-7 isoforms alpha and beta antibody
    • AKAP15 antibody
    • AKAP18 antibody
    • Akap7 antibody
    • HGNC377 antibody
    • OTTHUMP00000040266 antibody
    • Protein kinase A anchoring protein 7 antibody
    • Protein kinase A anchoring protein 7 isoform alpha antibody
    • Protein kinase A anchoring protein 7 isoform beta antibody
    • Protein kinase A anchoring protein 7 isoform gamma antibody
    • Protein kinase A anchoring protein 7 isoforms alpha/beta antibody
    • Protein kinase A-anchoring protein 7 isoforms alpha/beta antibody
    see all

Images

  • Paraffin-embedded human tonsil tissue stained for AKAP7 with ab236372 at 1/150 dilution in immunohistochemical analysis.

  • All lanes : Anti-AKAP7 antibody [OTI6F7] (ab236372) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY AKAP7 transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 11 kDa



    Cells transfected for 48 hours then lysed.

References

ab236372 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236372.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up