Overview

  • Product name
  • Description
    Rabbit polyclonal to AKIP
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human AKIP aa 137-197.
    Sequence:

    KMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAP EGWQTPKIYLR


    Database link: Q9NWT8

  • Positive control
    • IHC-P: Human colon tissue. ICC/IF: A431 cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab251818 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    May act as a negative regulator of Aurora-A kinase, by down-regulation through proteasome-dependent degradation.
  • Tissue specificity
    Ubiquitously expressed and especially highly expressed in heart, skeletal muscle and testis.
  • Cellular localization
    Mitochondrion. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • 28S ribosomal protein S38 antibody
    • AIP antibody
    • AKIP_HUMAN antibody
    • AURKA interacting protein antibody
    • AURKA-interacting protein antibody
    • AURKAIP 1 antibody
    • Aurkaip1 antibody
    • Aurora A kinase interacting protein antibody
    • Aurora kinase A interacting protein 1 antibody
    • Aurora kinase A-interacting protein antibody
    • FLJ20608 antibody
    • mitochondrial antibody
    • MRP-S38 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for AKIP (green) using ab251818 at 4 µg/ml in ICC/IF.
  • Paraffin-embedded human colon tissue stained for AKIP using ab251818 at 1/50 dilution in immunohistochemical analysis.

References

ab251818 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab251818.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up