Overview

  • Product name

  • Description

    Rabbit polyclonal to AKNA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human AKNA aa 118-221.
    Sequence:

    LDMTEEEPDGTLGSLEVEEAGESSSRLGYEAGLSLEGHGNTSPMALGHGQ ARGWVASGEQASGDKLSEHSEVNPSVELSPARSWSSGTVSLDHPSDSLDS TWEG


    Database link: Q7Z591

  • Positive control

    • SK-MEL-30 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220392 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    AKNA is a transcription factor that specifically activates the expression of the CD40 receptor and its ligand CD40L/CD154, two cell surface molecules on lymphocytes that are critical for antigen-dependent-B-cell development. It binds to A/T-rich promoters.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • AI597013 antibody
    • AKNA transcript F2 antibody
    • AT hook containing transcription factor antibody
    • AT hook transcription factor antibody
    • AT hook transcription factor AKNA antibody
    • FLJ31001 antibody
    • FLJ33184 antibody
    • KIAA1968 antibody
    • MGC116630 antibody
    • mKIAA1968 antibody
    • OTTHUMP00000021973 antibody
    • OTTHUMP00000021974 antibody
    • OTTMUSP00000015051 antibody
    • RP11 82I1.4 antibody
    • RP23-340H1.6 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized SK-MEL-30 cells labeling AKNA with ab220392 at 4 μg/ml (green).

References

ab220392 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220392.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up