Overview

  • Product name

    Anti-AKNA antibody - C-terminal
    See all AKNA primary antibodies
  • Description

    Rabbit polyclonal to AKNA - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Guinea pig, Cow, Pig
  • Immunogen

    Synthetic peptide within Human AKNA aa 550-599 (C terminal). The exact sequence is proprietary.
    Sequence:

    SSTPSPKQRSKQAGSSPRPPPGLWYLATAPPAPAPPAFAYISSVPIMPYP


    Database link: Q7Z591-5

  • Positive control

    • HepG2 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab178591 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 73 kDa.

Target

  • Relevance

    AKNA is a transcription factor that specifically activates the expression of the CD40 receptor and its ligand CD40L/CD154, two cell surface molecules on lymphocytes that are critical for antigen-dependent-B-cell development. It binds to A/T-rich promoters.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • AI597013 antibody
    • AKNA transcript F2 antibody
    • AT hook containing transcription factor antibody
    • AT hook transcription factor antibody
    • AT hook transcription factor AKNA antibody
    • FLJ31001 antibody
    • FLJ33184 antibody
    • KIAA1968 antibody
    • MGC116630 antibody
    • mKIAA1968 antibody
    • OTTHUMP00000021973 antibody
    • OTTHUMP00000021974 antibody
    • OTTMUSP00000015051 antibody
    • RP11 82I1.4 antibody
    • RP23-340H1.6 antibody
    see all

Images

  • Anti-AKNA antibody - C-terminal (ab178591) at 1 µg/ml + HepG2 cell line lysate at 10 µg

    Developed using the ECL technique.

    Predicted band size: 73 kDa


    Exposure time: 1 minute

References

This product has been referenced in:

  • Manzo-Merino J  et al. The Human Papillomavirus (HPV) E6 Oncoprotein Regulates CD40 Expression via the AT-Hook Transcription Factor AKNA. Cancers (Basel) 10:N/A (2018). Read more (PubMed: 30562965) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178591.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up