Overview

  • Product name

  • Description

    Rabbit polyclonal to AKR1C3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human AKR1C3 aa 1-323.
    Sequence:

    MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHID SAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALE NSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEA MEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRS KLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKR TPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD RNLHYFNSDSFASHPNYPYSDEY


    Database link: P42330

  • Positive control

    • WB: HeLa and K562 whole cell lysates. IHC-P: Human colon cancer and gallbladder tissues. IP: HepG2 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab236656 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 37 kDa.

Target

  • Function

    Catalyzes the conversion of aldehydes and ketones to alcohols. Catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ) and the oxidation of 9-alpha,11-beta-PGF2 to PGD2. Functions as a bi-directional 3-alpha-, 17-beta- and 20-alpha HSD. Can interconvert active androgens, estrogens and progestins with their cognate inactive metabolites. Preferentially transforms androstenedione (4-dione) to testosterone.
  • Tissue specificity

    Expressed in many tissues including adrenal gland, brain, kidney, liver, lung, mammary gland, placenta, small intestine, colon, spleen, prostate and testis. The dominant HSD in prostate and mammary gland. In the prostate, higher levels in epithelial cells than in stromal cells. In the brain, expressed in medulla, spinal cord, frontotemporal lobes, thalamus, subthalamic nuclei and amygdala. Weaker expression in the hippocampus, substantia nigra and caudate.
  • Sequence similarities

    Belongs to the aldo/keto reductase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 17 beta HSD 5 antibody
    • 17 beta hydroxysteroid dehydrogenase type 5 antibody
    • 17-beta-HSD 5 antibody
    • 17-beta-hydroxysteroid dehydrogenase type 5 antibody
    • 2-dihydrobenzene-1 antibody
    • 2-diol dehydrogenase antibody
    • 20 alpha-hydroxysteroid dehydrogenase antibody
    • 20-alpha-hydroxysteroid dehydrogenase antibody
    • 3 alpha hydroxysteroid dehydrogenase type II antibody
    • 3-alpha-HSD type 2 antibody
    • 3-alpha-HSD type II antibody
    • 3-alpha-HSD type II, brain antibody
    • 3-alpha-hydroxysteroid dehydrogenase type 2 antibody
    • AK1C3_HUMAN antibody
    • AKR1 C3 antibody
    • Akr1c18 antibody
    • AKR1C3 antibody
    • Aldo keto reductase family 1 member C3 antibody
    • Aldo-keto reductase family 1 member C3 antibody
    • brain antibody
    • Chlordecone reductase antibody
    • Chlordecone reductase homolog HAKRb antibody
    • DD-3 antibody
    • DD3 antibody
    • DDH1 antibody
    • DDX antibody
    • Dihydrodiol dehydrogenase 3 antibody
    • Dihydrodiol dehydrogenase type I antibody
    • Dihydrodiol dehydrogenase X antibody
    • HA1753 antibody
    • HAKRB antibody
    • HAKRe antibody
    • hluPGFS antibody
    • HSD17B5 antibody
    • Indanol dehydrogenase antibody
    • KIAA0119 antibody
    • PGFS antibody
    • Prostaglandin F synthase antibody
    • Testosterone 17-beta-dehydrogenase 5 antibody
    • Trans-1 antibody
    • Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase antibody
    • Type IIb 3 alpha hydroxysteroid dehydrogenase antibody
    see all

Images

  • All lanes : Anti-AKR1C3 antibody (ab236656) at 1/500 dilution

    Lane 1 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 37 kDa

  • Paraffin-embedded human colon cancer tissue stained for AKR1C3 using ab236656 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gallbladder tissue stained for AKR1C3 using ab236656 at 1/100 dilution in immunohistochemical analysis.

  • AKR1C3 was immunoprecipitated from HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate with ab236656 at 1/200 dilution. 

    Lane 1: Rabbit control IgG instead of ab236656 in HepG2 whole cell lysate.
    Lane 2: ab236656 IP in HepG2 whol cell lysate.
    Lane 3: HepG2 whole cell lysate (10 µg). 

    For western blotting, an HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.

References

ab236656 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236656.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up