Overview

  • Product name

    Anti-AKR1C4 antibody
  • Description

    Rabbit polyclonal to AKR1C4
  • Host species

    Rabbit
  • Specificity

    This antibody detects endogenous levels of total AKR1C4 protein.
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Fusion protein corresponding to Human AKR1C4 aa 1-323. Full length fusion protein. The identity of the protein fusion partner is GST.
    Sequence:

    MDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFRHID SAYLYNNEEQ VGLAIRSKIADGSVKREDIFYTSKLWCTFFQPQMVQPA LESSLKKLQLDYVDLYLLHFPM ALKPGETPLPKDENGKVIFDTVDLSA TWEVMEKCKDAGLAKSIGVSNFNCRQLEMILNKP GLKYKPVCNQVECH PYLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWVDPNSPVLLEDPV LC ALAKKHKQTPALIALRYQLQRGVVVLAKSYNEQRIRENIQVFEFQLTSED MKVLDGLN RNYRYVVMDFLMDHPDYPFSDEY


    Database link: P17516

  • Positive control

    • Mouse liver tissue lysate. Human liver cancer tissue.
  • General notes

    Previously labelled as HSD3a. 

Properties

Applications

Our Abpromise guarantee covers the use of ab197973 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 37 kDa.
IHC-P 1/25 - 1/100.

Target

  • Function

    Catalyzes the transformation of the potent androgen dihydrotestosterone (DHT) into the less active form, 5-alpha-androstan-3-alpha,17-beta-diol (3-alpha-diol). Also has some 20-alpha-hydroxysteroid dehydrogenase activity. The biotransformation of the pesticide chlordecone (kepone) to its corresponding alcohol leads to increased biliary excretion of the pesticide and concomitant reduction of its neurotoxicity since bile is the major excretory route.
  • Tissue specificity

    Liver specific.
  • Sequence similarities

    Belongs to the aldo/keto reductase family.
  • Post-translational
    modifications

    The N-terminus is blocked.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3 alpha HSD1 antibody
    • 3-alpha-HSD1 antibody
    • 3-alpha-hydroxysteroid dehydrogenase type I antibody
    • AK1C4_HUMAN antibody
    • AKR1C4 antibody
    • Aldo keto reductase family 1 member C4 antibody
    • Aldo-keto reductase family 1 member C4 antibody
    • CDR antibody
    • Chlordecone reductase antibody
    • DD-4 antibody
    • DD4 antibody
    • Dihydrodiol dehydrogenase 4 antibody
    • HAKRA antibody
    • HSD3a antibody
    see all

Images

  • Anti-AKR1C4 antibody (ab197973) at 1/400 dilution + mouse liver tissue lysate at 40 µg

    Predicted band size: 37 kDa


    Exposure time: 5 seconds


    8% SDS-PAGE

  • Immunohistochemical analysis of paraffin-embedded human liver cancer tissue sections labeling AKR1C4 with ab197973 at a 1/30 dilution.

References

ab197973 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197973.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up