Description

  • Product name

    AKT1 + PKN2 peptide substrate
  • Animal free

    No
  • Nature

    Synthetic
    • Sequence

      [protein fragment, 39 aa]
    • Additional sequence information

      The 39 amino acids of PDKtide peptide sequence is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).

Specifications

Our Abpromise guarantee covers the use of ab204873 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    Functional Studies

  • Additional notes

    ab204873 (AKT1 + PKN2 peptide substrate) can be utilized as a substrate for the following active protein kinases:

     

    ab126914 (Active human CDC7 + DBF4 full length protein)
    ab70320 (Active human CDK9+CyclinK full length protein)
    ab60834 (Active human PDPK1 full length protein)

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

General Info

  • Cellular localization

    AKT1: Cytoplasm. Nucleus. Cell membrane. Nucleus after activation by integrin-linked protein kinase 1 (ILK1). Nuclear translocation is enhanced by interaction with TCL1A. Phosphorylation on Tyr-176 by TNK2 results in its localization to the cell membrane where it is targeted for further phosphorylations on Thr-308 and Ser-473 leading to its activation and the activated form translocates to the nucleus. PKN2: Cytoplasm.

References

ab204873 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204873.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up