For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    akt1-antibody-ab235958.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Protein Phosphorylation Ser / Thr Kinases PKB / AKT
Share by email

Anti-AKT1 antibody (ab235958)

  • Datasheet
  • SDS
Submit a review Submit a question References (10)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-AKT1 antibody (ab235958)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT1 antibody (ab235958)
  • ChIP - Anti-AKT1 antibody (ab235958)
  • Immunocytochemistry/ Immunofluorescence - Anti-AKT1 antibody (ab235958)
  • Immunoprecipitation - Anti-AKT1 antibody (ab235958)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT1 antibody (ab235958)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT1 antibody (ab235958)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT1 antibody (ab235958)

Key features and details

  • Rabbit polyclonal to AKT1
  • Suitable for: ChIP, IP, IHC-P, WB, ICC/IF
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Protein
Product image
Recombinant Human G-6-Pase protein (ab114563)
Primary
Product image
Anti-WNK1 antibody (ab137687)
Primary
Product image
Anti-RALY antibody [EPR10121] (ab170105)

View more associated products

Overview

  • Product name

    Anti-AKT1 antibody
    See all AKT1 primary antibodies
  • Description

    Rabbit polyclonal to AKT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ChIP, IP, IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Xenopus laevis
  • Immunogen

    Recombinant full length protein corresponding to Human AKT1 aa 1-480.
    Sequence:

    MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREA PLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWT TAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEF EYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENR VLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRA RFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFY NQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAK EIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITIT PPDQDDSMECVDSERRPHFPQFSYSASGTA


    Database link: P31749-1
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HeLa, A549, HepG2 and MCF7 whole cell lysate. IHC-P: Human prostate, tonsil, cervical cancer and brain tissue. ICC/IF: HeLa cells. IP: HepG2 whole cell lysate.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Constituents: 50% Glycerol, PBS, 0.03% Proclin 300
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Protein Phosphorylation
    • Ser / Thr Kinases
    • PKB / AKT
    • Epigenetics and Nuclear Signaling
    • Cell cycle
    • Apoptosis
    • Nuclear
    • Cancer
    • Signal transduction
    • Protein phosphorylation
    • Serine/threonine kinases
    • AKT
    • Metabolism
    • Pathways and Processes
    • Metabolism processes
    • Apoptosis
    • Cancer
    • Cell Death
    • Apoptosis
    • Metabolism

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • HeLa whole cell lysate (ab150035)
    • HepG2 whole cell lysate (ab166833)
    • MCF7 whole cell lysate (ab29537)
    • HeLa whole cell lysate (ab29545)
    • A549 whole cell lysate (ab7910)
  • Recombinant Protein

    • Recombinant human AKT1 protein (ab79792)
  • Related Products

    • Recombinant Human AKT1 protein (ab116412)
    • Recombinant human AKT1 protein (Active) (ab62279)

Applications

Our Abpromise guarantee covers the use of ab235958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ChIP Use 4µg for 106 cells.
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000.
ICC/IF 1/100 - 1/500.

Target

  • Function

    Plays a role as a key modulator of the AKT-mTOR signaling pathway controlling the tempo of the process of newborn neurons integration during adult neurogenesis, including correct neuron positioning, dendritic development and synapse formation (By similarity). General protein kinase capable of phosphorylating several known proteins. Phosphorylates TBC1D4. Signals downstream of phosphatidylinositol 3-kinase (PI(3)K) to mediate the effects of various growth factors such as platelet-derived growth factor (PDGF), epidermal growth factor (EGF), insulin and insulin-like growth factor I (IGF-I). Plays a role in glucose transport by mediating insulin-induced translocation of the GLUT4 glucose transporter to the cell surface. Mediates the antiapoptotic effects of IGF-I. Mediates insulin-stimulated protein synthesis by phosphorylating TSC2 at 'Ser-939' and 'Thr-1462', thereby activating mTORC1 signaling and leading to both phosphorylation of 4E-BP1 and in activation of RPS6KB1. Promotes glycogen synthesis by mediating the insulin-induced activation of glycogen synthase. The activated form can suppress FoxO gene transcription and promote cell cycle progression. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly.
  • Tissue specificity

    Expressed in all human cell types so far analyzed. The Tyr-176 phosphorylated form shows a significant increase in expression in breast cancers during the progressive stages i.e. normal to hyperplasia (ADH), ductal carcinoma in situ (DCIS), invasive ductal carcinoma (IDC) and lymph node metastatic (LNMM) stages.
  • Involvement in disease

    Defects in AKT1 are a cause of susceptibility to breast cancer (BC) [MIM:114480]. A common malignancy originating from breast epithelial tissue. Breast neoplasms can be distinguished by their histologic pattern. Invasive ductal carcinoma is by far the most common type. Breast cancer is etiologically and genetically heterogeneous. Important genetic factors have been indicated by familial occurrence and bilateral involvement. Mutations at more than one locus can be involved in different families or even in the same case.
    Defects in AKT1 are associated with colorectal cancer (CRC) [MIM:114500].
    Defects in AKT1 are associated with susceptibility to ovarian cancer [MIM:604370]; also called susceptibility to familial breast-ovarian cancer type 1 (BROVCA1).
  • Sequence similarities

    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. RAC subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 PH domain.
    Contains 1 protein kinase domain.
  • Domain

    Binding of the PH domain to the phosphatidylinositol 3-kinase alpha (PI(3)K) results in its targeting to the plasma membrane. The PH domain mediates interaction with TNK2 and Tyr-176 is also essential for this interaction.
    The AGC-kinase C-terminal mediates interaction with THEM4.
  • Post-translational
    modifications

    Phosphorylation on Thr-308, Ser-473 and Tyr-474 is required for full activity. Activated TNK2 phosphorylates it on Tyr-176 resulting in its binding to the anionic plasma membrane phospholipid PA. This phosphorylated form localizes to the cell membrane, where it is targeted by PDPK1 and PDPK2 for further phosphorylations on Thr-308 and Ser-473 leading to its activation. Ser-473 phosphorylation by mTORC2 favors Thr-308 phosphorylation by PDPK1. Ser-473 phosphorylation is enhanced by interaction with AGAP2 isoform 2 (PIKE-A). Ser-473 phosphorylation is enhanced in focal cortical dysplasias with Taylor-type balloon cells.
    Ubiquitinated; undergoes both 'Lys-48'- and 'Lys-63'-linked polyubiquitination. TRAF6-induced 'Lys-63'-linked AKT1 ubiquitination is critical for phosphorylation and activation. When ubiquitinated, it translocates to the plasma membrane, where it becomes phosphorylated. When fully phosphorylated and translocated into the nucleus, undergoes 'Lys-48'-polyubiquitination catalyzed by TTC3, leading to its degradation by the proteasome.
  • Cellular localization

    Cytoplasm. Nucleus. Cell membrane. Nucleus after activation by integrin-linked protein kinase 1 (ILK1). Nuclear translocation is enhanced by interaction with TCL1A. Phosphorylation on Tyr-176 by TNK2 results in its localization to the cell membrane where it is targeted for further phosphorylations on Thr-308 and Ser-473 leading to its activation and the activated form translocates to the nucleus.
  • Target information above from: UniProt accession P31749 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 280991 Cow
    • Entrez Gene: 207 Human
    • Entrez Gene: 11651 Mouse
    • Entrez Gene: 24185 Rat
    • Entrez Gene: 399170 Xenopus laevis
    • Omim: 164730 Human
    • SwissProt: Q01314 Cow
    • SwissProt: P31749 Human
    • SwissProt: P31750 Mouse
    • SwissProt: P47196 Rat
    • SwissProt: Q98TY9 Xenopus laevis
    • Unigene: 525622 Human
    • Unigene: 6645 Mouse
    • Unigene: 11422 Rat
    • Unigene: 738 Xenopus laevis
    see all
  • Alternative names

    • AKT 1 antibody
    • AKT antibody
    • AKT1 antibody
    • AKT1_HUMAN antibody
    • C AKT antibody
    • cAKT antibody
    • MGC99656 antibody
    • PKB alpha antibody
    • PKB antibody
    • PKB-ALPHA antibody
    • PRKBA antibody
    • Protein Kinase B Alpha antibody
    • Protein kinase B antibody
    • Proto-oncogene c-Akt antibody
    • RAC Alpha antibody
    • RAC antibody
    • Rac protein kinase alpha antibody
    • RAC Serine/Threonine Protein Kinase antibody
    • RAC-alpha serine/threonine-protein kinase antibody
    • RAC-PK-alpha antibody
    • v akt murine thymoma viral oncogene homolog 1 antibody
    • vAKT Murine Thymoma Viral Oncogene Homolog 1 antibody
    see all

Images

  • Western blot - Anti-AKT1 antibody (ab235958)
    Western blot - Anti-AKT1 antibody (ab235958)
    All lanes : Anti-AKT1 antibody (ab235958) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 4 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT1 antibody (ab235958)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT1 antibody (ab235958)

    Paraffin-embedded human cervical cancer tissue stained for AKT1 using ab235958 at 1/100 dilution in immunohistochemical analysis.

  • ChIP - Anti-AKT1 antibody (ab235958)
    ChIP - Anti-AKT1 antibody (ab235958)

    Chromatin Immunoprecipitation HeLa (Human epithelial cell line from cervix adenocarcinoma) (1.1x106) were cross-linked with formaldehyde, sonicated and immunoprecipitated with 4 µg of ab235958 or a control normal rabbit IgG. The resulting ChIP DNA was quantified tissue using real-time PCR with primers against the exon-1 of Egr1 promoter.

  • Immunocytochemistry/ Immunofluorescence - Anti-AKT1 antibody (ab235958)
    Immunocytochemistry/ Immunofluorescence - Anti-AKT1 antibody (ab235958)

    HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for AKT1 (Green) using ab235958 at a 1/100 dilution in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). Counterstained with DAPI (Blue).

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C.

  • Immunoprecipitation - Anti-AKT1 antibody (ab235958)
    Immunoprecipitation - Anti-AKT1 antibody (ab235958)

    AKT1 was immunoprecipitated from 500 μg of HepG2 (Human liver hepatocellular carcinoma cell line) whole cell lysate. For western blotting, an HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.

    Lane 1: Rabbit control IgG instead of ab235958.
    Lane 2: ab235958 IP in HepG2 whole cell lysate.
    Lane 3: HepG2 whole cell lysate (input).

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT1 antibody (ab235958)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT1 antibody (ab235958)

    Paraffin-embedded human prostate tissue stained for AKT1 using ab235958 at 1/100 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT1 antibody (ab235958)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT1 antibody (ab235958)

    Paraffin-embedded human brain tissue stained for AKT1 using ab235958 at 1/200 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT1 antibody (ab235958)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AKT1 antibody (ab235958)

    Paraffin-embedded human tonsil tissue stained for AKT1 using ab235958 at 1/100 dilution in immunohistochemical analysis.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
    • SDS
  • References (10)

    Publishing research using ab235958? Please let us know so that we can cite the reference in this datasheet.

    ab235958 has been referenced in 10 publications.

    • Zhou X  et al. Long noncoding RNA BSN-AS2 induced by E2F1 promotes spinal osteosarcoma progression by targeting miR-654-3p/SYTL2 axis. Cancer Cell Int 20:133 (2020). PubMed: 32351327
    • Wang B  et al. Upregulation of contactin-1 expression promotes prostate cancer progression. Oncol Lett 19:1611-1618 (2020). PubMed: 32002038
    • Wei F  et al. Plasma endothelial cells-derived extracellular vesicles promote wound healing in diabetes through YAP and the PI3K/Akt/mTOR pathway. Aging (Albany NY) 12:12002-12018 (2020). PubMed: 32570219
    • Xie T  et al. microRNA-582 Potentiates Liver and Lung Metastasis of Gastric Carcinoma Cells Through the FOXO3-Mediated PI3K/Akt/Snail Pathway. Cancer Manag Res 12:5201-5212 (2020). PubMed: 32636681
    • Luo Y  et al. Effects of MiR-107 on The Chemo-drug Sensitivity of Breast Cancer Cells. Open Med (Wars) 14:59-65 (2019). PubMed: 31346547
    • Sang B  et al. Ras-AKT signaling represses the phosphorylation of histone H1.5 at threonine 10 via GSK3 to promote the progression of glioma. Artif Cells Nanomed Biotechnol 47:2882-2890 (2019). PubMed: 31307224
    • Li C  et al. HIF-1a/VEGF signaling-mediated epithelial-mesenchymal transition and angiogenesis is critically involved in anti-metastasis effect of luteolin in melanoma cells. Phytother Res 33:798-807 (2019). PubMed: 30653763
    • Huo X  et al. Clinical and Expression Significance of AKT1 by Co-expression Network Analysis in Endometrial Cancer. Front Oncol 9:1147 (2019). PubMed: 31781484
    • Tian Y  et al. CXCL12 induces migration of oligodendrocyte precursor cells through the CXCR4-activated MEK/ERK and PI3K/AKT pathways. Mol Med Rep 18:4374-4380 (2018). PubMed: 30221695
    • Liu F  et al. Overexpression of SENP1 reduces the stemness capacity of osteosarcoma stem cells and increases their sensitivity to HSVtk/GCV. Int J Oncol 53:2010-2020 (2018). PubMed: 30226577

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab235958.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.