Overview

  • Product name

  • Description

    Rabbit polyclonal to AL5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human AL5 aa 21-141.
    Sequence:

    EESSDEQPDEVESPTQSQDSTPAEEREDEGASAAQGQEPEADSQELVQPK TGCELGDGPDTKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDG PDVQELGLPNPEEVKTPEEDE


    Database link: O75459

  • Positive control

    • IHC-P: Human testis tissue. ICC/IF: A431 cells.
  • General notes

    Previously labelled as PAGE1. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Tissue specificity

    Isolated from prostate cancer cell lines; expression associated with progression to androgen insensitive phenotype. Expressed in normal testis and at lower level in normal placenta.
  • Sequence similarities

    Belongs to the GAGE family.
  • Information by UniProt
  • Database links

  • Alternative names

    • AL5 antibody
    • G antigen 9 antibody
    • G antigen family B member 1 antibody
    • GAGB1_HUMAN antibody
    • GAGE 9 antibody
    • GAGE-9 antibody
    • GAGE9 antibody
    • GAGEB1 antibody
    • P antigen family, member 1 (prostate associated) antibody
    • PAGE 1 antibody
    • PAGE-1 antibody
    • PAGE1 antibody
    • Prostate-associated gene 1 protein antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for AL5 using ab224329 at 1/200 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for AL5 (green) using ab224329 at 4 µg/ml in ICC/IF.

References

ab224329 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224329.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up