Overview

  • Product name

    Anti-Alanine Transaminase antibody
    See all Alanine Transaminase primary antibodies
  • Description

    Rabbit polyclonal to Alanine Transaminase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Alanine Transaminase aa 147-263. (Expressed in E.coli).
    Sequence:

    IPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYPLYSATL AELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVINPGNPT GQVQTRECIEAVIRFAF


    Database link: Q8TD30

  • Positive control

    • IHC-P: Human breast cancer, kidney, liver, thyroid cancer, and liver cancer tissues. WB: Recombinant human Alanine Transaminase protein; Mouse liver, kidney and cerebrum lysates; Rat liver lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231715 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 55 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. Participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.
  • Tissue specificity

    Liver, kidney, heart, and skeletal muscles. Expressed at moderate levels in the adipose tissue.
  • Pathway

    Amino-acid degradation; L-alanine degradation via transaminase pathway; pyruvate from L-alanine: step 1/1.
  • Sequence similarities

    Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. Alanine aminotransferase subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • AAT1 antibody
    • Alanine aminotransferase 1 antibody
    • Alanine aminotransferase antibody
    • ALAT1_HUMAN antibody
    • ALT1 antibody
    • Glutamate pyruvate transaminase 1 antibody
    • Glutamic alanine transaminase 1 antibody
    • Glutamic pyruvate transaminase (alanine aminotransferase) antibody
    • Glutamic pyruvic transaminase 1 antibody
    • Glutamic--alanine transaminase 1 antibody
    • Glutamic--pyruvic transaminase 1 antibody
    • GPT 1 antibody
    • gpt antibody
    • GPT1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Alanine Transaminase using ab231715 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Alanine Transaminase using ab231715 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver cancer tissue stained for Alanine Transaminase using ab231715 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Alanine Transaminase antibody (ab231715) at 2 µg/ml + Rat liver lysate

    Predicted band size: 55 kDa

  • Anti-Alanine Transaminase antibody (ab231715) at 2 µg/ml + Mouse cerebrum lysate

    Predicted band size: 55 kDa

  • Anti-Alanine Transaminase antibody (ab231715) at 2 µg/ml + Mouse kidney lysate

    Predicted band size: 55 kDa

  • Anti-Alanine Transaminase antibody (ab231715) at 2 µg/ml + Mouse liver lysate

    Predicted band size: 55 kDa

  • Anti-Alanine Transaminase antibody (ab231715) at 2 µg/ml + Recombinant human Alanine Transaminase protein

    Predicted band size: 55 kDa

  • Formalin-fixed, paraffin-embedded human thryoid cancer tissue stained for Alanine Transaminase using ab231715 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Alanine Transaminase using ab231715 at 20 µg/ml in immunohistochemical analysis. AEC staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for Alanine Transaminase using ab231715 at 20 µg/ml in immunohistochemical analysis. AEC staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for Alanine Transaminase using ab231715 at 20 µg/m in immunohistochemical analysis. DAB staining.

References

ab231715 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231715.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up