Overview

  • Product name

    Anti-Alcohol Dehydrogenase antibody
    See all Alcohol Dehydrogenase primary antibodies
  • Description

    Rabbit polyclonal to Alcohol Dehydrogenase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
    Predicted to work with: Rhesus monkey, Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Alcohol Dehydrogenase aa 169-370. (Expressed in E.coli).
    Sequence:

    KVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAIMGCKAAGAA RIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFE VIGRLDTMMASLLCCHEACGTSVIVGVPPDSQNLSMNPMLLLTGRTWKGA ILGGFKSKECVPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKS IR


    Database link: P07327

  • Positive control

    • IHC-P: Human breast cancer, stomach, skin cancer, liver, lung cancer and stomach cancer tissues. WB: Pig and rat liver lysates; Recombinant human Alcohol Dehydrogenase protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231521 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 40 kDa.

Target

Images

  • Paraffin-embedded human breast cancer tissue stained for Alcohol Dehydrogenase using ab231521 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • araffin-embedded human stomach tissue stained for Alcohol Dehydrogenase using ab231521 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human skin cancer tissue stained for Alcohol Dehydrogenase using ab231521 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver tissue stained for Alcohol Dehydrogenase using ab231521 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human lung cancer tissue stained for Alcohol Dehydrogenase using ab231521 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach cancer tissue stained for Alcohol Dehydrogenase using ab231521 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Alcohol Dehydrogenase antibody (ab231521) at 2 µg/ml + Recombinant human Alcohol Dehydrogenase protein

    Predicted band size: 40 kDa

  • Anti-Alcohol Dehydrogenase antibody (ab231521) at 2 µg/ml + Pig liver lysate

    Predicted band size: 40 kDa

  • Anti-Alcohol Dehydrogenase antibody (ab231521) at 1.5 µg/ml + Rat liver lysate

    Predicted band size: 40 kDa

References

ab231521 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231521.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up