Anti-ALD1 antibody (ab229984)
Key features and details
- Rabbit polyclonal to ALD1
- Suitable for: WB
- Reacts with: Staphylococcus aureus
- Isotype: IgG
Overview
-
Product name
Anti-ALD1 antibody -
Description
Rabbit polyclonal to ALD1 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Staphylococcus aureus -
Immunogen
Recombinant full length protein corresponding to Staphylococcus aureus ALD1 aa 1-372. (with a SUMO tag on the N-terminal).
Sequence:MLVAVVKELKQGEGRVACTPENVRKLTDAGHKVIVEKNAGIGSGFSNDMY EKEGAKIVTHEQAWEADLVIKVKEPHESEYQYFKKNQIIWGFLHLASSKE IVEKMQEVGVTAISGETIIKNGKAELLAPMSAIAGQRSAIMGAYYSEAQH GGQGTLVTGVHENVDIPGSTYVIFGGGVAATNAANVALGLNAKVIIIELN DDRIKYLEDMYAEKDVTVVKSTPENLAEQIKKADVFISTILIPGAKPPKL VTREMVKSMKKGSVLIDIAIDQGGTIETIRPTTISDPVYEEEGVIHYGVP NQPGAVPRTSTMALAQGNIDYILEICDKGLEQAIKDNEALSTGVNIYQGQ VTNQGLASSHDLDYKEILNVIE
Database link: P63478 -
Positive control
- WB: Recombinant Staphylococcus aureus ALD1 protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab229984 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/5000. Detects a band of approximately 57 kDa (predicted molecular weight: 40 kDa). |
Images
-
All lanes : Anti-ALD1 antibody (ab229984) at 1/500 dilution
Lane 1 : Recombinant Staphylococcus aureus ALD1 protein, 100 ng
Lane 2 : Recombinant Staphylococcus aureus ALD1 protein, 50 ng
Lane 3 : Recombinant Staphylococcus aureus ALD1 protein, 25 ng
Lane 4 : Recombinant Staphylococcus aureus ALD1 protein, 12.5 ng
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 40 kDa
Observed band size: 57 kDa why is the actual band size different from the predicted?Predicted MW of recombinant Staphylococcus aureus ALD1 protein with a SUMO tag on the N-terminal: 57 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab229984 has not yet been referenced specifically in any publications.