Overview

  • Product name

  • Description

    Rabbit polyclonal to ALDH1B1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ALDH1B1 aa 278-517.
    Sequence:

    NLKRVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFV EESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLG QKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKF KKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVT CHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS


    Database link: P30837

  • Positive control

    • IHC-P: Human breast cancer and testis tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab238482 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation.
  • Tissue specificity

    Liver, testis and to a lesser extent in brain.
  • Pathway

    Alcohol metabolism; ethanol degradation; acetate from ethanol: step 2/2.
  • Sequence similarities

    Belongs to the aldehyde dehydrogenase family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acetaldehyde dehydrogenase 5 antibody
    • AL1B1_HUMAN antibody
    • Aldehyde dehydrogenase 1 family, member B1 antibody
    • Aldehyde dehydrogenase 1B1 antibody
    • Aldehyde dehydrogenase 5 antibody
    • Aldehyde dehydrogenase family 1 member B1 antibody
    • Aldehyde dehydrogenase X antibody
    • Aldehyde dehydrogenase X mitochondrial antibody
    • ALDH class 2 antibody
    • Aldh1b1 antibody
    • ALDH5 antibody
    • ALDHX antibody
    • MGC2230 antibody
    • Mitochondrial aldehyde dehydrogenase X antibody
    • mitochondrial antibody
    • OTTHUMP00000021399 antibody
    see all

Images

  • Paraffin-embedded human breast cancer tissue stained for ALDH1B1 using ab238482 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for ALDH1B1 using ab238482 at 1/100 dilution in immunohistochemical analysis.

References

ab238482 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238482.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up