Anti-ALDH1B1 antibody (ab246928)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-ALDH1B1 antibody
See all ALDH1B1 primary antibodies -
Description
Rabbit polyclonal to ALDH1B1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human ALDH1B1 aa 1-68.
Sequence:MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVS KKTFPTVNPTTGEVIGHV
Database link: P30837 -
Positive control
- IHC-P: Human liver tissue. ICC/IF: U-2 OS cells. WB: RT4 and U-251 MG cell lysate; Human liver and tonsil tissue lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab246928 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| WB | Use a concentration of 0.4 µg/ml. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Function
ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. -
Tissue specificity
Liver, testis and to a lesser extent in brain. -
Pathway
Alcohol metabolism; ethanol degradation; acetate from ethanol: step 2/2. -
Sequence similarities
Belongs to the aldehyde dehydrogenase family. -
Cellular localization
Mitochondrion matrix. - Information by UniProt
-
Database links
- Entrez Gene: 219 Human
- Omim: 100670 Human
- SwissProt: P30837 Human
- Unigene: 436219 Human
-
Alternative names
- Acetaldehyde dehydrogenase 5 antibody
- AL1B1_HUMAN antibody
- Aldehyde dehydrogenase 1 family, member B1 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-ALDH1B1 antibody (ab246928)PFA fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells labeling ALDH1B1 using ab246928 at 4 µg/ml (green) in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ALDH1B1 antibody (ab246928)Paraffin-embedded human liver tissue stained for ALDH1B1 using ab246928 at 1/1000 dilution in immunohistochemical analysis. -
Western blot - Anti-ALDH1B1 antibody (ab246928)All lanes : Anti-ALDH1B1 antibody (ab246928) at 0.4 µg/ml
Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate
Lane 3 : Human plasma (IgG/HSA depleted)
Lane 4 : Human liver tissue lysate
Lane 5 : Human tonsil tissue lysate
Datasheets and documents
References
ab246928 has not yet been referenced specifically in any publications.
