Anti-ALDH1B1 antibody (ab246928)
Key features and details
- Rabbit polyclonal to ALDH1B1
- Suitable for: IHC-P, WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ALDH1B1 antibody
See all ALDH1B1 primary antibodies -
Description
Rabbit polyclonal to ALDH1B1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human ALDH1B1 aa 1-68.
Sequence:MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVS KKTFPTVNPTTGEVIGHV
Database link: P30837 -
Positive control
- IHC-P: Human liver, kidney, and cerebral cortex tissue; ICC/IF: U-2 OS cells; WB: RT4 and U-251 MG cell lysate; Human liver and tonsil tissue lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab246928 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | Use a concentration of 0.04 - 0.4 µg/ml. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. -
Tissue specificity
Liver, testis and to a lesser extent in brain. -
Pathway
Alcohol metabolism; ethanol degradation; acetate from ethanol: step 2/2. -
Sequence similarities
Belongs to the aldehyde dehydrogenase family. -
Cellular localization
Mitochondrion matrix. - Information by UniProt
-
Database links
- Entrez Gene: 219 Human
- Omim: 100670 Human
- SwissProt: P30837 Human
- Unigene: 436219 Human
-
Alternative names
- Acetaldehyde dehydrogenase 5 antibody
- AL1B1_HUMAN antibody
- Aldehyde dehydrogenase 1 family, member B1 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ALDH1B1 antibody (ab246928)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human liver tissue labelling ALDH1B1 with ab246928 at 1/1000 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
PFA fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells labeling ALDH1B1 using ab246928 at 4 µg/ml (green) in ICC/IF.
-
All lanes : Anti-ALDH1B1 antibody (ab246928) at 0.4 µg/ml
Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate
Lane 3 : Human plasma (IgG/HSA depleted)
Lane 4 : Human liver tissue lysate
Lane 5 : Human tonsil tissue lysate -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ALDH1B1 antibody (ab246928)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling ALDH1B1 with ab246928 at 1/1000 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ALDH1B1 antibody (ab246928)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human cerebral cortex tissue labelling ALDH1B1 with ab246928 at 1/1000 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ALDH1B1 antibody (ab246928)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human tonsil tissue labelling ALDH1B1 with ab246928 at 1/1000 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab246928 has not yet been referenced specifically in any publications.