Overview

  • Product name

  • Description

    Rabbit polyclonal to ALDH3B1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human ALDH3B1 aa 168-449.
    Sequence:

    GGPQETGQLLEHRFDYIFFTGSPRVGKIVMTAAAKHLTPVTLELGGKNPC YVDDNCDPQTVANRVAWFRYFNAGQTCVAPDYVLCSPEMQERLLPALQST ITRFYGDDPQSSPNLGRIINQKQFQRLRALLGCGRVAIGGQSDESDRYIA PTVLVDVQEMEPVMQEEIFGPILPIVNVQSLDEAIEFINRREKPLALYAF SNSSQVVKRVLTQTSSGGFCGNDGFMHMTLASLPFGGVGASGMGRYHGKF SFDTFSHHRACLLRSPGMEKLNALRYPPQSPR


    Database link: P43353

  • Positive control

    • WB: K562 whole cell lysate; Rat kidney and spleen tissue lysate; Mouse stomach tissue lysate. ICC/IF: A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236673 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
ICC/IF 1/50 - 1/200.

Target

Images

  • All lanes : Anti-ALDH3B1 antibody (ab236673) at 1/500 dilution

    Lane 1 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 2 : Rat kidney tissue lysate
    Lane 3 : Rat spleen tissue lysate
    Lane 4 : Mouse stomach tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
  • A549 (human lung carcinoma cell line) cells labeling ALD3B1 (green) using ab236673 at 1/100 dilution in ICC/IF. Secondary antibody was Alexa Fluor 488-conjugated goat anti-rabbit IgG (H+L).

References

ab236673 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236673.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up