Overview

  • Product name

  • Description

    Rabbit polyclonal to ALDH3B2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ALDH3B2 aa 57-311.
    Sequence:

    KPSEISQGTEKVLAEVLPQYLDQSCFAVVLGGPQETGQLLEHKLDYIFFT GSPRVGKIVMTAATKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFCY FNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGHIIN QKQFQRLRALLGCSRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIFG PILPIVNVQSVDEAIKFINRQEKPLALYAFSNSSQVVNQMLERTSSGSFG GNEGF


    Database link: P48448

  • Positive control

    • IHC-P: Human adrenal gland tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238866 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Tissue specificity

    Salivary gland.
  • Pathway

    Alcohol metabolism; ethanol degradation; acetate from ethanol: step 2/2.
  • Sequence similarities

    Belongs to the aldehyde dehydrogenase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acetaldehyde dehydrogenase 8 antibody
    • AL3B2_HUMAN antibody
    • Aldehyde dehydrogenase 3 family, member B2 antibody
    • Aldehyde dehydrogenase 8 antibody
    • Aldehyde dehydrogenase family 3 member B2 antibody
    • ALDH3B2 antibody
    • ALDH8 antibody
    • OTTHUMP00000235616 antibody
    see all

Images

  • Paraffin-embedded human adrenal gland tissue stained for ALDH3B2 using ab238866 at 1/100 dilution in immunohistochemical analysis.

References

ab238866 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238866.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up