Overview

  • Product name

  • Description

    Rabbit polyclonal to ALDH7A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human ALDH7A1 aa 1-539. (Expressed in E.coli)
    Sequence:

    MWRLPRALCVHAAKTSKLSGPWSRPAAFMSTLLINQPQYAWLKELGLREE NEGVYNGSWGGRGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWK IWADIPAPKRGEIVRQIGDALREKIQVLGSLVSLEMGKILVEGVGEVQEY VDICDYAVGLSRMIGGPILPSERSGHALIEQWNPVGLVGIITAFNFPVAV YGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLEDNKLPGAICSL TCGGADIGTAMAKDERVNLLSFTGSTQVGKQVGLMVQERFGRSLLELGGN NAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRL KKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGK VMDRPGNYVEPTIVTGLGHDASIAHTETFAPILYVFKFKNEEEVFAWNNE VKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEK HTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ


    Database link: P49419

  • Positive control

    • IHC-P: Human kidney tissue. WB: Recombinant human ALDH7A1 protein; Rat liver and kidney lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab232848 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 58 kDa.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • 26g turgor protein homolog antibody
    • AL7A1_HUMAN antibody
    • Aldehyde dehydrogenase 7 A1 antibody
    • Aldehyde dehydrogenase 7 family, member A1 antibody
    • Aldehyde dehydrogenase family 7 member A1 antibody
    • ALDH7A1 antibody
    • Alpha AASA dehydrogenase antibody
    • Alpha aminoadipic semialdehyde dehydrogenase antibody
    • Alpha-AASA dehydrogenase antibody
    • Alpha-aminoadipic semialdehyde dehydrogenase antibody
    • Antiquitin 1 antibody
    • Antiquitin antibody
    • Antiquitin-1 antibody
    • ATQ1 antibody
    • Betaine aldehyde dehydrogenase antibody
    • Delta1 piperideine 6 carboxylate dehydrogenease antibody
    • Delta1-piperideine-6-carboxylate dehydrogenase antibody
    • EPD antibody
    • P6c dehydrogenase antibody
    • PDE antibody
    see all

Images

  • Anti-ALDH7A1 antibody (ab232848) at 2 µg/ml + Rat kidney tissue lysate.

    Predicted band size: 58 kDa

  • Anti-ALDH7A1 antibody (ab232848) at 2 µg/ml + Rat liver tissue lysate.

    Predicted band size: 58 kDa

  • Anti-ALDH7A1 antibody (ab232848) at 2 µg/ml + Recombinant human ALDH7A1 protein.

    Predicted band size: 58 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for ALDH7A1 using ab232848 at 20µg/mL in immunohistochemical analysis. DAB staining.

References

ab232848 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232848.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up