Overview

  • Product name

  • Description

    Rabbit polyclonal to ALDH7A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IP, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human ALDH7A1 aa 386-515.
    Sequence:

    EEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHDASIAHTETFAPILYV FKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNI PTSGAEIGGAFGGEKHTGGGRESGSDAWKQ


    Database link: P49419

  • Positive control

    • WB: HeLa, HepG2, HEK-293T and SH-SY5Y cell lysate; Rat liver and kidney lysate; Mouse liver and kidney lysate. IHC-P: Human kidney and liver tissue. ICC/IF: HeLa cells. IP: HeLa cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab236663 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IP 1/200 - 1/2000.
IHC-P 1/200 - 1/500.
WB 1/500 - 1/5000.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • 26g turgor protein homolog antibody
    • AL7A1_HUMAN antibody
    • Aldehyde dehydrogenase 7 A1 antibody
    • Aldehyde dehydrogenase 7 family, member A1 antibody
    • Aldehyde dehydrogenase family 7 member A1 antibody
    • ALDH7A1 antibody
    • Alpha AASA dehydrogenase antibody
    • Alpha aminoadipic semialdehyde dehydrogenase antibody
    • Alpha-AASA dehydrogenase antibody
    • Alpha-aminoadipic semialdehyde dehydrogenase antibody
    • Antiquitin 1 antibody
    • Antiquitin antibody
    • Antiquitin-1 antibody
    • ATQ1 antibody
    • Betaine aldehyde dehydrogenase antibody
    • Delta1 piperideine 6 carboxylate dehydrogenease antibody
    • Delta1-piperideine-6-carboxylate dehydrogenase antibody
    • EPD antibody
    • P6c dehydrogenase antibody
    • PDE antibody
    see all

Images

  • All lanes : Anti-ALDH7A1 antibody (ab236663) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 3 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 4 : SH-SY5Y (human neuroblastoma cell line from bone marrow) whole cell lysate
    Lane 5 : Rat liver lysate
    Lane 6 : Rat kidney lysate
    Lane 7 : Mouse liver lysate
    Lane 8 : Mouse kidney lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human kidney tissue stained for ALDH7A1 using ab236663 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human liver tissue stained for ALDH7A1 using ab236663 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for ALDH7A1 using ab236663 at a dilution of 1/133 in ICC/IF.
    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • ALDH7A1 was immunoprecipitated from HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate using ab236663. 

    Lane 1: Rabbit control IgG instead of ab236663 in HeLa whole cell lysate.
    Lane 2: 6 µg ab236663 IP in HeLa whole cell lysate.
    Lane 3: HeLa whole cell lysate 20 µg (Input). 

References

ab236663 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236663.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up