Overview

  • Product name

  • Description

    Rabbit polyclonal to ALDH9A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ALDH9A1 aa 266-403.
    Sequence:

    DCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRI KIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDP KLKDGYYMRPCVLTNCRDDMTCVKEEIFGPVMSILSFD


    Database link: P49189

  • Positive control

    • WB: RT4, U-251 MG sp, NIH/3T3 and NBT-II cell lysates; Human liver and tonsil lysates. IHC-P: Human liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 54 kDa.

Target

  • Function

    Converts gamma-trimethylaminobutyraldehyde into gamma-butyrobetaine. Catalyzes the irreversible oxidation of a broad range of aldehydes to the corresponding acids in an NAD-dependent reaction.
  • Tissue specificity

    High expression in adult liver, skeletal muscle, and kidney. Low levels in heart, pancreas, lung and brain. Expressed in all regions of the brain. Expression levels are variable in the different brain areas, with the highest levels in the spinal cord and the lowest in the occipital pole.
  • Pathway

    Amine and polyamine biosynthesis; carnitine biosynthesis.
  • Sequence similarities

    Belongs to the aldehyde dehydrogenase family.
  • Developmental stage

    Strongly expressed in human embryonic brain (gestational age 12 weeks).
  • Post-translational
    modifications

    The N-terminus is blocked.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4 trimethylaminobutyraldehyde dehydrogenase antibody
    • 4-trimethylaminobutyraldehyde dehydrogenase antibody
    • AL9A1_HUMAN antibody
    • aldehyde dehydrogenase (NAD+) antibody
    • Aldehyde dehydrogenase 9A1 antibody
    • Aldehyde dehydrogenase E3 isozyme antibody
    • Aldehyde dehydrogenase family 9 member A1 antibody
    • ALDH4 antibody
    • ALDH7 antibody
    • ALDH9 antibody
    • aldh9A1 antibody
    • E3 antibody
    • Gamma aminobutyraldehyde dehydrogenase antibody
    • Gamma-aminobutyraldehyde dehydrogenase antibody
    • R aminobutyraldehyde dehydrogenase antibody
    • R-aminobutyraldehyde dehydrogenase antibody
    • TMABADH antibody
    see all

Images

  • Paraffin-embedded human liver tissue stained for ALDH9A1 with ab224360 at 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-ALDH9A1 antibody (ab224360) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate
    Lane 3 : Human plasma (IgG/HSA depleted)
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Predicted band size: 54 kDa

  • All lanes : Anti-ALDH9A1 antibody (ab224360) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Predicted band size: 54 kDa

References

ab224360 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224360.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up