Overview

  • Product name

  • Description

    Rabbit polyclonal to Aldolase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Chimpanzee, Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Aldolase aa 18-273. Expressed in E. coli. N-terminal tag.
    Sequence:

    DIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTAD DRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLA GTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMEN ANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKAL SDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTG ITFLSG


    Database link: P04075

  • Positive control

    • IHC-P: Human liver cancer, cerebrum, thyroid cancer, glioma, liver and prostate cancer tissue. WB: Recombinant human Aldolase protein; Mouse cerebrum and heart tissue lysate; HepG2 cell lysate; Human liver tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab232786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 39 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Plays a key role in glycolysis and gluconeogenesis. In addition, may also function as scaffolding protein.
  • Pathway

    Carbohydrate degradation; glycolysis; D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose: step 4/4.
  • Involvement in disease

    Defects in ALDOA are the cause of glycogen storage disease type 12 (GSD12) [MIM:611881]; also known as red cell aldolase deficiency. A metabolic disorder associated with increased hepatic glycogen and hemolytic anemia. It may lead to myopathy with exercise intolerance and rhabdomyolysis.
  • Sequence similarities

    Belongs to the class I fructose-bisphosphate aldolase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • ALDA antibody
    • Aldo1 antibody
    • ALDOA antibody
    • ALDOA_HUMAN antibody
    • Aldolase 1 antibody
    • Aldolase A antibody
    • Aldolase A fructose bisphosphatase antibody
    • Aldolase A fructose bisphosphate antibody
    • Aldolase, fructose-bisphosphate A antibody
    • Epididymis secretory sperm binding protein Li 87p antibody
    • FRUCTOALDOLASE A antibody
    • Fructose 1 6 bisphosphate triosephosphate lyase antibody
    • Fructose bisphosphate aldolase A antibody
    • Fructose bisphosphate aldolase antibody
    • FRUCTOSE-1,6-BISPHOSPHATE ALDOLASE A antibody
    • Fructose-bisphosphate aldolase A antibody
    • Fructose-bisphosphate aldolase A Muscle-type antibody
    • GSD12 antibody
    • HEL S 87p antibody
    • Lung cancer antigen NY LU 1 antibody
    • Lung cancer antigen NY-LU-1 antibody
    • MGC10942 antibody
    • MGC17716 antibody
    • MGC17767 antibody
    • Muscle type aldolase antibody
    • Muscle-type aldolase antibody
    • RNALDOG5 antibody
    see all

Images

  • Anti-Aldolase antibody (ab232786) at 2 µg/ml + Mouse heart lysate

    Predicted band size: 39 kDa

  • Formalin-fixed, paraffin-embedded human liver cancer tissue stained for Aldolase with ab232786 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Aldolase with ab232786 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for Aldolase with ab232786 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human thyroid cancer tissue stained for Aldolase with ab232786 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for Aldolase with ab232786 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for Aldolase with ab232786 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Aldolase antibody (ab232786) at 2 µg/ml + HepG2 (Human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 39 kDa

  • Anti-Aldolase antibody (ab232786) at 2 µg/ml + Mouse cerebrum lysate

    Predicted band size: 39 kDa

  • Anti-Aldolase antibody (ab232786) at 2 µg/ml + Human liver tissue lysate

    Predicted band size: 39 kDa

  • Anti-Aldolase antibody (ab232786) at 2 µg/ml + Recombinant human Aldolase protein

    Predicted band size: 39 kDa

References

ab232786 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up