Overview

  • Product name

    Anti-Aldolase antibody (HRP)
    See all Aldolase primary antibodies
  • Description

    Goat polyclonal to Aldolase (HRP)
  • Host species

    Goat
  • Conjugation

    HRP
  • Tested applications

    Suitable for: IP, ELISA, WBmore details
  • Species reactivity

    Reacts with: Rabbit, Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Full length native protein (purified) corresponding to Rabbit Aldolase aa 1-364. Purified from Rabbit Muscle.
    Sequence:

    MPHSHPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTE NTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKS KGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRC VLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLK RCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKYSHEEIA MATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTF SYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAG AAASESLFIS NHAY


    Database link: P00883

  • Positive control

    • A293 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab181662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP 1/100.
ELISA 1/5000 - 1/20000.
WB 1/500 - 1/5000. Predicted molecular weight: 39 kDa.

Target

  • Function

    Plays a key role in glycolysis and gluconeogenesis. In addition, may also function as scaffolding protein.
  • Pathway

    Carbohydrate degradation; glycolysis; D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose: step 4/4.
  • Involvement in disease

    Defects in ALDOA are the cause of glycogen storage disease type 12 (GSD12) [MIM:611881]; also known as red cell aldolase deficiency. A metabolic disorder associated with increased hepatic glycogen and hemolytic anemia. It may lead to myopathy with exercise intolerance and rhabdomyolysis.
  • Sequence similarities

    Belongs to the class I fructose-bisphosphate aldolase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • ALDA antibody
    • Aldo1 antibody
    • ALDOA antibody
    • ALDOA_HUMAN antibody
    • Aldolase 1 antibody
    • Aldolase A antibody
    • Aldolase A fructose bisphosphatase antibody
    • Aldolase A fructose bisphosphate antibody
    • Aldolase, fructose-bisphosphate A antibody
    • Epididymis secretory sperm binding protein Li 87p antibody
    • FRUCTOALDOLASE A antibody
    • Fructose 1 6 bisphosphate triosephosphate lyase antibody
    • Fructose bisphosphate aldolase A antibody
    • Fructose bisphosphate aldolase antibody
    • FRUCTOSE-1,6-BISPHOSPHATE ALDOLASE A antibody
    • Fructose-bisphosphate aldolase A antibody
    • Fructose-bisphosphate aldolase A Muscle-type antibody
    • GSD12 antibody
    • HEL S 87p antibody
    • Lung cancer antigen NY LU 1 antibody
    • Lung cancer antigen NY-LU-1 antibody
    • MGC10942 antibody
    • MGC17716 antibody
    • MGC17767 antibody
    • Muscle type aldolase antibody
    • Muscle-type aldolase antibody
    • RNALDOG5 antibody
    see all

Images

  • Anti-Aldolase antibody (HRP) (ab181662) at 1/1000 dilution + A293 whole cell lysate

    Developed using the ECL technique.

    Predicted band size: 39 kDa



    4-12% tris glycine gradient gel for SDS-PAGE

  • Immunoprecipitation and Western Blot analysis.

    300 µl aliquots of whole anti-aldolase antiserum were used to precipitate varying amounts of purified aldolase and precipitates with controls were compared by SDS-PAGE and Western blot. Samples shown in the image are:

    1. Purified aldolase

    2. 300 µl antiserum with no antigen (negative control)

    3. 300 µl antiserum with ~100 µl aldolase (2.5 mg/ml)

    4. 300 µl antiserum with ~200 µl aldolase (2.5 mg/ml)

  • Immunoprecipitation was performed with 300 μl of anti-Aldolase antiserum and an equal volume of varied amounts (diluted from a stock solution of ~2.5 mg/ml) of purified aldolase in PBS. 

    1. Purified Aldolase (1μg)

    2. Precipitation negative control (antiserum + No antigen)

    3. 300 μl antiserum + 20 μl Aldolase

    4. 300 μl antiserum + 80 μl Aldolase

    5. 300 μl antiserum + 120 μl Aldolase

    6. 300 μl antiserum + 150 μl Aldolase

    7. 300 μl antiserum + 300 μl Aldolase

References

This product has been referenced in:

  • Zhang W  et al. Effects of Vitamin A on Expressions of Apoptosis Genes Bax and Bcl-2 in Epithelial Cells of Corneal Tissues Induced by Benzalkonium Chloride in Mice with Dry Eye. Med Sci Monit 25:4583-4589 (2019). Read more (PubMed: 31257361) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up