Anti-Aldose reductase antibody (ab175394)
Key features and details
- Rabbit polyclonal to Aldose reductase
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Aldose reductase antibody
See all Aldose reductase primary antibodies -
Description
Rabbit polyclonal to Aldose reductase -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rabbit, Pig -
Immunogen
Recombinant full length protein corresponding to Human Aldose reductase aa 1-316.
Sequence:MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQ NENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDL KLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVD EGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYC QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI RFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA LLSCTSHKDYPFHEEF
Database link: P15121 -
Positive control
- Human liver extract.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab175394 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/50 - 1/200.
ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
|
WB |
1/500 - 1/2000. Predicted molecular weight: 35 kDa.
|
Notes |
---|
IHC-P
1/50 - 1/200. ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
WB
1/500 - 1/2000. Predicted molecular weight: 35 kDa. |
Target
-
Function
Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols with a broad range of catalytic efficiencies. -
Tissue specificity
Highly expressed in embryonic epithelial cells (EUE) in response to osmotic stress. -
Sequence similarities
Belongs to the aldo/keto reductase family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 231 Human
- Entrez Gene: 396816 Pig
- Entrez Gene: 100009122 Rabbit
- Omim: 103880 Human
- SwissProt: P15121 Human
- SwissProt: P80276 Pig
- SwissProt: P15122 Rabbit
- Unigene: 521212 Human
-
Alternative names
- ADR antibody
- AKR1B 1 antibody
- Akr1b1 antibody
see all
Images
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (8)
ab175394 has been referenced in 8 publications.
- Deng M et al. Scutellarin acts on the AR-NOX axis to remediate oxidative stress injury in a mouse model of cerebral ischemia/reperfusion injury. Phytomedicine 103:154214 (2022). PubMed: 35689902
- Leung D et al. Platinum-resistance in epithelial ovarian cancer: an interplay of epithelial-mesenchymal transition interlinked with reprogrammed metabolism. J Transl Med 20:556 (2022). PubMed: 36463238
- Koike S et al. Age-related alteration in the distribution of methylglyoxal and its metabolic enzymes in the mouse brain. Brain Res Bull 144:164-170 (2019). PubMed: 30508605
- Samaddar S & Koneri R Polyphenols of marine red macroalga Symphyocladia latiuscula ameliorate diabetic peripheral neuropathy in experimental animals. Heliyon 5:e01781 (2019). PubMed: 31193485
- He J et al. The aldose reductase inhibitor epalrestat exerts nephritic protection on diabetic nephropathy in db/db mice through metabolic modulation. Acta Pharmacol Sin N/A:N/A (2018). PubMed: 29930278
- Chen X et al. AKR1B1 Upregulation Contributes to Neuroinflammation and Astrocytes Proliferation by Regulating the Energy Metabolism in Rat Spinal Cord Injury. Neurochem Res 43:1491-1499 (2018). PubMed: 29948725
- Morgenstern J et al. Loss of Glyoxalase 1 Induces Compensatory Mechanism to Achieve Dicarbonyl Detoxification in Mammalian Schwann Cells. J Biol Chem 292:3224-3238 (2017). PubMed: 27956549
- Zhao Y et al. Proteomic analysis revealed the altered kidney protein profile of a Cyld knockout mouse model. Genet Mol Res 14:5970-8 (2015). PubMed: 26125796