Overview

  • Product name
    Anti-Aldose reductase antibody
    See all Aldose reductase primary antibodies
  • Description
    Rabbit polyclonal to Aldose reductase
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human Aldose reductase aa 1-316.
    Sequence:

    MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQ NENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDL KLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVD EGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYC QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI RFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA LLSCTSHKDYPFHEEF


    Database link: P15121

  • Positive control
    • Human liver extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab175394 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 35 kDa.

Target

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human esophageal cancer tissue labelling Aldose reductase with ab175394 at 1/200. Magnification: 200x.

  • Anti-Aldose reductase antibody (ab175394) at 1/500 dilution + Human liver extract

    Predicted band size: 35 kDa

References

This product has been referenced in:
  • Zhao Y  et al. Proteomic analysis revealed the altered kidney protein profile of a Cyld knockout mouse model. Genet Mol Res 14:5970-8 (2015). Read more (PubMed: 26125796) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175394.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up