Alexa Fluor® 488 Anti-FOXP3 antibody [3G3] (ab187598)
Key features and details
- Alexa Fluor® 488 Mouse monoclonal [3G3] to FOXP3
- Suitable for: Flow Cyt
- Reacts with: Mouse, Human
- Conjugation: Alexa Fluor® 488. Ex: 495nm, Em: 519nm
- Isotype: IgG1
Overview
-
Product name
Alexa Fluor® 488 Anti-FOXP3 antibody [3G3]
See all FOXP3 primary antibodies -
Description
Alexa Fluor® 488 Mouse monoclonal [3G3] to FOXP3 -
Host species
Mouse -
Conjugation
Alexa Fluor® 488. Ex: 495nm, Em: 519nm -
Tested applications
Suitable for: Flow Cytmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant full length protein (His-tag) corresponding to Mouse FOXP3 aa 1-429.
Sequence:MPNPRPAKPMAPSLALGPSPGVLPSWKTAPKGSELLGTRGSGGPFQGRDL RSGAHTSSSLNPLPPSQLQLPTVPLVMVAPSGARLGPSPHLQALLQDRPH FMHQLSTVDAHAQTPVLQVRPLDNPAMISLPPPSAATGVFSLKARPGLPP GINVASLEWVSREPALLCTFPRSGTPRKDSNLLAAPQGSYPLLANGVCKW PGCEKVFEEPEEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKE KLGAMQAHLAGKMALAKAPSVASMDKSSCCIVATSTQGSVLPAWSAPREA PDGGLFAVRRHLWGSHGNSSFPEFFHNMDYFKYHNMRPPFTYATLIRWAI LEAPERQRTLNEIYHWFTRMFAYFRNHPATWKNAIRHNLSLHKCFVRVES EKGAVWTVDEFEFRKKRSQRPNKCSNPCP
Database link: Q99JB6 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Store In the Dark. -
Storage buffer
pH: 7.40
Preservative: 0.097% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Size exclusion -
Purification notes
Purified antibody is conjugated with Alexa Fluor® 488 under optimum conditions. The conjugate is purified by size-exclusion chromatography. -
Clonality
Monoclonal -
Clone number
3G3 -
Isotype
IgG1 -
Research areas
Associated products
-
Alternative Versions
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab187598 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
Flow Cyt | Use a concentration of 4 µg/ml. ab171463 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.
|
Target
-
Function
Probable transcription factor. Plays a critical role in the control of immune response. -
Involvement in disease
Defects in FOXP3 are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX) [MIM:304790]; also known as X-linked autoimmunity-immunodeficiency syndrome. IPEX is characterized by neonatal onset insulin-dependent diabetes mellitus, infections, secretory diarrhea, trombocytopenia, anemia and eczema. It is usually lethal in infancy. -
Sequence similarities
Contains 1 C2H2-type zinc finger.
Contains 1 fork-head DNA-binding domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 50943 Human
- Entrez Gene: 20371 Mouse
- Omim: 300292 Human
- SwissProt: Q9BZS1 Human
- SwissProt: Q99JB6 Mouse
- Unigene: 247700 Human
- Unigene: 182291 Mouse
-
Alternative names
- AIID antibody
- DIETER antibody
- Forkhead box P3 antibody
see all
Images
Datasheets and documents
References (0)
ab187598 has not yet been referenced specifically in any publications.