Alexa Fluor® 488 Anti-PSMA antibody [GCP05] (ab187570)
Key features and details
- Alexa Fluor® 488 Mouse monoclonal [GCP05] to PSMA
- Reacts with: Human
- Conjugation: Alexa Fluor® 488. Ex: 495nm, Em: 519nm
- Isotype: IgG1
Overview
-
Product name
Alexa Fluor® 488 Anti-PSMA antibody [GCP05]
See all PSMA primary antibodies -
Description
Alexa Fluor® 488 Mouse monoclonal [GCP05] to PSMA -
Host species
Mouse -
Conjugation
Alexa Fluor® 488. Ex: 495nm, Em: 519nm -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Pig -
Immunogen
Recombinant fragment corresponding to Human PSMA aa 44-750. Extracellular domain
Sequence:KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLA KQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSL FEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMK INCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYP DGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIP VHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVK MHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAA VVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQ ERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSL YESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWET NKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVL PFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIA SKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYA PSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAA ETLSEVA
Database link: Q04609 -
Positive control
- LNCaP cell line.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Store In the Dark. -
Storage buffer
pH: 7.4
Preservative: 0.097% Sodium azide
Constituents: 99% PBS, 0.2% BSA -
Concentration information loading...
-
Purity
Size exclusion -
Clonality
Monoclonal -
Clone number
GCP05 -
Isotype
IgG1 -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
Target
-
Function
Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity. Has a preference for tri-alpha-glutamate peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory neurotransmission through the hydrolysis of the neuropeptide, N-aceylaspartylglutamate (NAAG), thereby releasing glutamate. Isoform PSM-4 and isoform PSM-5 would appear to be physiologically irrelevant. Involved in prostate tumor progression.
Also exhibits a dipeptidyl-peptidase IV type activity. In vitro, cleaves Gly-Pro-AMC. -
Tissue specificity
Highly expressed in prostate epithelium. Detected in urinary bladder, kidney, testis, ovary, fallopian tube, breast, adrenal gland, liver, esophagus, stomach, small intestine, colon and brain (at protein level). Detected in the small intestine, brain, kidney, liver, spleen, colon, trachea, spinal cord and the capillary endothelium of a variety of tumors. Expressed specifically in jejunum brush border membranes. In the brain, highly expressed in the ventral striatum and brain stem. Also expressed in fetal liver and kidney. Isoform PSMA' is the most abundant form in normal prostate. Isoform PSMA-1 is the most abundant form in primary prostate tumors. Isoform PSMA-2 is also found in normal prostate as well as in brain and liver. Isoform PSMA-9 is specifically expressed in prostate cancer. -
Sequence similarities
Belongs to the peptidase M28 family. M28B subfamily. -
Domain
The NAALADase activity is found in the central region, the dipeptidyl peptidase IV type activity in the C-terminal. -
Post-translational
modificationsThe first two amino acids at the N-terminus of isoform PSMA' appear to be cleaved by limited proteolysis.
The N-terminus is blocked. -
Cellular localization
Cytoplasm and Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 2346 Human
- Entrez Gene: 53320 Mouse
- Entrez Gene: 397677 Pig
- Entrez Gene: 85309 Rat
- Omim: 600934 Human
- SwissProt: Q04609 Human
- SwissProt: O35409 Mouse
- SwissProt: O77564 Pig
see all -
Alternative names
- Cell growth inhibiting protein 27 antibody
- Cell growth-inhibiting gene 27 protein antibody
- FGCP antibody
see all
References (0)
ab187570 has not yet been referenced specifically in any publications.