For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    alexa-fluor-488-psma-antibody-gcp05-ab187570.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Metabolism Amino Acids
Share by email

Alexa Fluor® 488 Anti-PSMA antibody [GCP05] (ab187570)

  • Datasheet
  • SDS
Reviews (1) Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Key features and details

  • Alexa Fluor® 488 Mouse monoclonal [GCP05] to PSMA
  • Reacts with: Human
  • Conjugation: Alexa Fluor® 488. Ex: 495nm, Em: 519nm
  • Isotype: IgG1

You may also be interested in

Protein
Product image
Recombinant Mouse PSMA protein (His tag) (ab219283)

View more associated products

Overview

  • Product name

    Alexa Fluor® 488 Anti-PSMA antibody [GCP05]
    See all PSMA primary antibodies
  • Description

    Alexa Fluor® 488 Mouse monoclonal [GCP05] to PSMA
  • Host species

    Mouse
  • Conjugation

    Alexa Fluor® 488. Ex: 495nm, Em: 519nm
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Pig
  • Immunogen

    Recombinant fragment corresponding to Human PSMA aa 44-750. Extracellular domain
    Sequence:

    KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLA KQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSL FEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMK INCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYP DGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIP VHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVK MHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAA VVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQ ERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSL YESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWET NKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVL PFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIA SKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYA PSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAA ETLSEVA


    Database link: Q04609
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • LNCaP cell line.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C. Store In the Dark.
  • Storage buffer

    pH: 7.4
    Preservative: 0.097% Sodium azide
    Constituents: 99% PBS, 0.2% BSA
  • Concentration information loading...
  • Purity

    Size exclusion
  • Clonality

    Monoclonal
  • Clone number

    GCP05
  • Isotype

    IgG1
  • Research areas

    • Signal Transduction
    • Metabolism
    • Amino Acids
    • Cancer
    • Tumor biomarkers
    • Other
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Amino acid metabolism

Associated products

  • Isotype control

    • AlexaFluor ® 488 Mouse IgG1 [MOPC-21] - Isotype Control (ab234075)
  • Recombinant Protein

    • Recombinant Mouse PSMA protein (His tag) (ab219283)

Target

  • Function

    Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity. Has a preference for tri-alpha-glutamate peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory neurotransmission through the hydrolysis of the neuropeptide, N-aceylaspartylglutamate (NAAG), thereby releasing glutamate. Isoform PSM-4 and isoform PSM-5 would appear to be physiologically irrelevant. Involved in prostate tumor progression.
    Also exhibits a dipeptidyl-peptidase IV type activity. In vitro, cleaves Gly-Pro-AMC.
  • Tissue specificity

    Highly expressed in prostate epithelium. Detected in urinary bladder, kidney, testis, ovary, fallopian tube, breast, adrenal gland, liver, esophagus, stomach, small intestine, colon and brain (at protein level). Detected in the small intestine, brain, kidney, liver, spleen, colon, trachea, spinal cord and the capillary endothelium of a variety of tumors. Expressed specifically in jejunum brush border membranes. In the brain, highly expressed in the ventral striatum and brain stem. Also expressed in fetal liver and kidney. Isoform PSMA' is the most abundant form in normal prostate. Isoform PSMA-1 is the most abundant form in primary prostate tumors. Isoform PSMA-2 is also found in normal prostate as well as in brain and liver. Isoform PSMA-9 is specifically expressed in prostate cancer.
  • Sequence similarities

    Belongs to the peptidase M28 family. M28B subfamily.
  • Domain

    The NAALADase activity is found in the central region, the dipeptidyl peptidase IV type activity in the C-terminal.
  • Post-translational
    modifications

    The first two amino acids at the N-terminus of isoform PSMA' appear to be cleaved by limited proteolysis.
    The N-terminus is blocked.
  • Cellular localization

    Cytoplasm and Cell membrane.
  • Target information above from: UniProt accession Q04609 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 2346 Human
    • Entrez Gene: 53320 Mouse
    • Entrez Gene: 397677 Pig
    • Entrez Gene: 85309 Rat
    • Omim: 600934 Human
    • SwissProt: Q04609 Human
    • SwissProt: O35409 Mouse
    • SwissProt: O77564 Pig
    • SwissProt: P70627 Rat
    • Unigene: 654487 Human
    • Unigene: 269137 Mouse
    • Unigene: 89278 Rat
    see all
  • Alternative names

    • Cell growth inhibiting protein 27 antibody
    • Cell growth-inhibiting gene 27 protein antibody
    • FGCP antibody
    • Folate hydrolase (prostate-specific membrane antigen) 1 antibody
    • Folate hydrolase 1 antibody
    • Folate hydrolase antibody
    • Folate hydrolase prostate specific membrane antigen 1 antibody
    • FOLH 1 antibody
    • FOLH antibody
    • Folh1 antibody
    • FOLH1_HUMAN antibody
    • Folylpoly gamma glutamate carboxypeptidase antibody
    • Folylpoly-gamma-glutamate carboxypeptidase antibody
    • GCP 2 antibody
    • GCP II antibody
    • GCP2 antibody
    • GCPII antibody
    • GIG27 antibody
    • Glutamate carboxylase II antibody
    • Glutamate carboxypeptidase 2 antibody
    • Glutamate carboxypeptidase II antibody
    • Membrane glutamate carboxypeptidase antibody
    • mGCP antibody
    • N acetylated alpha linked acidic dipeptidase 1 antibody
    • N-acetylated-alpha-linked acidic dipeptidase I antibody
    • NAALAD 1 antibody
    • NAALAD1 antibody
    • NAALAdase antibody
    • NAALADase I antibody
    • Prostate specific membrane antigen antibody
    • Prostate specific membrane antigen variant F antibody
    • Prostate-specific membrane antigen antibody
    • PSM antibody
    • PSMA antibody
    • Pteroylpoly gamma glutamate carboxypeptidase antibody
    • Pteroylpoly-gamma-glutamate carboxypeptidase antibody
    see all

Protocols

  • Flow cytometry protocols

Click here to view the general protocols

Datasheets and documents

    • Datasheet
    • SDS
  • References (0)

    Publishing research using ab187570? Please let us know so that we can cite the reference in this datasheet.

    ab187570 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Immunocytochemistry/ Immunofluorescence abreview for Anti-PSMA antibody [GCP05] (Alexa Fluor® 488)

    Good
    Abreviews
    Abreviews
    abreview image
    Application
    Immunocytochemistry/ Immunofluorescence
    Sample
    Human Cell (LNCaP cell line)
    Permeabilization
    No
    Specification
    LNCaP cell line
    Fixative
    Formaldehyde
    Read More

    Abcam user community

    Verified customer

    Submitted Mar 31 2017

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.