Alexa Fluor® 647 Anti-DcR2 antibody [TRAIL-R4-01] (ab243076)
![Flow Cytometry - Alexa Fluor® 647 Anti-DcR2 antibody [TRAIL-R4-01] (ab243076)](https://www.abcam.com/ps/products/243/ab243076/Images/ab243076-332258-ab243076.jpg "Flow Cytometry - Alexa Fluor® 647 Anti-DcR2 antibody [TRAIL-R4-01] (ab243076)")
Key features and details
- Alexa Fluor® 647 Mouse monoclonal [TRAIL-R4-01] to DcR2
- Suitable for: Flow Cyt
- Reacts with: Human
- Conjugation: Alexa Fluor® 647. Ex: 652nm, Em: 668nm
- Isotype: IgG1
Overview
-
Product name
Alexa Fluor® 647 Anti-DcR2 antibody [TRAIL-R4-01]
See all DcR2 primary antibodies -
Description
Alexa Fluor® 647 Mouse monoclonal [TRAIL-R4-01] to DcR2 -
Host species
Mouse -
Conjugation
Alexa Fluor® 647. Ex: 652nm, Em: 668nm -
Tested applications
Suitable for: Flow Cytmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human DcR2 aa 1-210. Fused to hIgGhc.
Sequence:MGLWGQSVPTASSARAGRYPGARTASGTRPWLLDPKILKFVVFIVAVLLP VRVDSATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCT EGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKN SPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVT TILGMLASPY
Database link: Q9UBN6 -
Positive control
- Flow Cyt: DcR2-transfectants.
-
General notes
Alexa Fluor® is a registered trademark of Molecular Probes, Inc, a Thermo Fisher Scientific Company. The Alexa Fluor® dye included in this product is provided under an intellectual property license from Life Technologies Corporation. As this product contains the Alexa Fluor® dye, the purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). As this product contains the Alexa Fluor® dye the sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: in manufacturing; (ii) to provide a service, information, or data in return for payment (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are sold for use in research. For information on purchasing a license to this product for purposes other than research, contact Life Technologies Corporation, 5781 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@thermofisher.com.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Store In the Dark. -
Storage buffer
pH: 7.40
Preservative: 0.0975% Sodium azide
Constituent: PBS -
Concentration information loading... -
Purity
Size exclusion -
Purification notes
Purified antibody is conjugated with Alexa Fluor® 647 under optimum conditions. The conjugate is purified by size-exclusion chromatography. -
Clonality
Monoclonal -
Clone number
TRAIL-R4-01 -
Isotype
IgG1 -
Research areas
Applications
Our Abpromise guarantee covers the use of ab243076 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| Flow Cyt | Use at an assay dependent concentration. |
Target
-
Function
Receptor for the cytotoxic ligand TRAIL. Contains a truncated death domain and hence is not capable of inducing apoptosis but protects against TRAIL-mediated apoptosis. Reports are contradictory with regards to its ability to induce the NF-kappa-B pathway. According to PubMed:9382840, it cannot but according to PubMed:9430226, it can induce the NF-kappa-B pathway. -
Tissue specificity
Widely expressed, in particular in fetal kidney, lung and liver, and in adult testis and liver. Also expressed in peripheral blood leukocytes, colon and small intestine, ovary, prostate, thymus, spleen, pancreas, kidney, lung, placenta and heart. -
Sequence similarities
Contains 1 death domain.
Contains 3 TNFR-Cys repeats. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 8793 Human
- Omim: 603614 Human
- SwissProt: Q9UBN6 Human
- Unigene: 213467 Human
-
Alternative names
- CD 264 antibody
- CD264 antibody
- DcR 2 antibody
see all
Images
-
Flow Cytometry - Alexa Fluor® 647 Anti-DcR2 antibody [TRAIL-R4-01] (ab243076)
Flow cytometric analysis of DcR2-transfectants labeling DcR2 with ab243076.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243076 has not yet been referenced specifically in any publications.
