Overview

  • Product name

    Anti-Alkaline Phosphatase, Tissue Non-Specific antibody
    See all Alkaline Phosphatase, Tissue Non-Specific primary antibodies
  • Description

    Rabbit polyclonal to Alkaline Phosphatase, Tissue Non-Specific
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Cat
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Alkaline Phosphatase, Tissue Non-Specific aa 18-335. (Expressed in E.coli).
    Sequence:

    LVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTV TAARILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAY LCGVKANEGTVGVSAATERSRCNTTQGNEVTSILRWAKDAGKSVGIVTTT RVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDV IMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSH FIWNRTELLTLDPHNVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAI QILRKNPKGFFLLVEGGR


    Database link: P05186

  • Positive control

    • WB: Recombinant human Alkaline Phosphatase, Tissue Non-Specific protein; HeLa cell lysate. IHC-P: Human pancreas, prostate cancer, glioma and breast cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231646 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231646 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 57 kDa.

Target

  • Function

    This isozyme may play a role in skeletal mineralization.
  • Involvement in disease

    Hypophosphatasia
    Hypophosphatasia childhood type
    Hypophosphatasia infantile type
  • Sequence similarities

    Belongs to the alkaline phosphatase family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AKP2 antibody
    • Alkaline phosphatase liver/bone/kidney antibody
    • Alkaline phosphatase liver/bone/kidney isozyme antibody
    • Alkaline phosphatase tissue nonspecific isozyme antibody
    • Alkaline phosphatase, tissue-nonspecific isozyme antibody
    • Alkaline phosphomonoesterase antibody
    • Alpl antibody
    • AP TNAP antibody
    • AP-TNAP antibody
    • APTNAP antibody
    • BAP antibody
    • FLJ40094 antibody
    • FLJ93059 antibody
    • Glycerophosphatase antibody
    • HOPS antibody
    • Liver/bone/kidney type alkaline phosphatase antibody
    • MGC161443 antibody
    • MGC167935 antibody
    • PHOA antibody
    • PPBT_HUMAN antibody
    • Tissue non specific alkaline phosphatase antibody
    • Tissue nonspecific ALP antibody
    • TNAP antibody
    • TNSALP antibody
    see all

Images

  • Anti-Alkaline Phosphatase, Tissue Non-Specific antibody (ab231646) at 3 µg/ml + Recombinat human Alkaline Phosphatase, Tissue Non-Specific protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 57 kDa

  • Anti-Alkaline Phosphatase, Tissue Non-Specific antibody (ab231646) at 3 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 57 kDa

  • Paraffin-embedded human pancreas cancer tissue stained for Alkaline Phosphatase, Tissue Non-Specific using ab231646 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate cancer tissue stained for Alkaline Phosphatase, Tissue Non-Specific using ab231646 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human glioma tissue stained for Alkaline Phosphatase, Tissue Non-Specific using ab231646 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human breast cancer tissue stained for Alkaline Phosphatase, Tissue Non-Specific using ab231646 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231646 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231646.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up