Overview

  • Product name
  • Description
    Rabbit polyclonal to ALKBH2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human ALKBH2 aa 173-255.
    Sequence:

    DDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRRVAVVRLPLAHGS LLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRK


    Database link: Q6NS38

  • Positive control
    • ICC/IF: HEK 293 cells.
  • General notes

    Previously labelled as ABH2. 

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220042 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function
    Dioxygenase that repairs alkylated DNA and RNA containing 1-methyladenine and 3-methylcytosine by oxidative demethylation. Can also repair alkylated DNA containing 1-ethenoadenine (in vitro). Has strong preference for double-stranded DNA. Has low efficiency with single-stranded substrates. Requires molecular oxygen, alpha-ketoglutarate and iron.
  • Tissue specificity
    Detected in colon, small intestine, ovary, testis, prostate, skeletal muscle, heart, liver and urinary bladder.
  • Sequence similarities
    Belongs to the alkB family.
    Contains 1 Fe2OG dioxygenase domain.
  • Cellular localization
    Nucleus. Detected in replication foci during S-phase.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2OG Fe(II) oxy DC1 antibody
    • 9530023G02 antibody
    • ABH 2 antibody
    • ABH2 antibody
    • alkB alkylation repair homolog 2 antibody
    • ALKB2_HUMAN antibody
    • ALKBH2 alkB antibody
    • ALKBH2 antibody
    • Alkylated DNA repair protein alkB homolog antibody
    • Alkylated DNA repair protein alkB homolog 2 antibody
    • Alkylation repair homolog 2 antibody
    • Alpha ketoglutarate dependent dioxygenase alkB homolog 2 antibody
    • Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2 antibody
    • AU016977 antibody
    • DNA oxidative demethylase ALKBH2 antibody
    • EC 1.14.11. antibody
    • FLJ99103 antibody
    • hABH2 antibody
    • mABH2 antibody
    • MGC90512 antibody
    • Oxy DC1 antibody
    see all

Images

  • Immunofluorescent analysis of formalin fixed, triton X-100 permeabilized HEK 293 cells labeling ALKBH2 using ab220042 at 4 μg/ml (green).

References

ab220042 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220042.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
For licensing inquiries, please contact partnerships@abcam.com

Sign up