Anti-ALKBH3 antibody (ab220403)
Key features and details
- Rabbit polyclonal to ALKBH3
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ALKBH3 antibody
See all ALKBH3 primary antibodies -
Description
Rabbit polyclonal to ALKBH3 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow -
Immunogen
Recombinant fragment corresponding to Human ALKBH3 aa 151-263.
Sequence:NPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGR CPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGA TQADWQHRVPKEY
Database link: Q96Q83 -
Positive control
- ICC/IF - A431 cells
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab220403 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. |
Target
-
Function
Dioxygenase that repairs alkylated DNA containing 1-methyladenine and 3-methylcytosine by oxidative demethylation. Has a strong preference for single-stranded DNA. May also act on RNA. Requires molecular oxygen, alpha-ketoglutarate and iron. -
Tissue specificity
Ubiquitous. Detected in heart, pancreas, skeletal muscle, thymus, testis, ovary, spleen, prostate, small intestine, peripheral blood leukocytes, urinary bladder and colon. -
Sequence similarities
Belongs to the alkB family.
Contains 1 Fe2OG dioxygenase domain. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 514579 Cow
- Entrez Gene: 221120 Human
- Entrez Gene: 69113 Mouse
- Entrez Gene: 362169 Rat
- Omim: 610603 Human
- SwissProt: Q32L00 Cow
- SwissProt: Q96Q83 Human
- SwissProt: Q8K1E6 Mouse
see all -
Alternative names
- 1700108H04Rik antibody
- 1810020C19Rik antibody
- ABH3 antibody
see all
Images
Protocols
Datasheets and documents
References (0)
ab220403 has not yet been referenced specifically in any publications.