Anti-ALKBH7 antibody (ab204568)
Key features and details
- Rabbit polyclonal to ALKBH7
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ALKBH7 antibody
See all ALKBH7 primary antibodies -
Description
Rabbit polyclonal to ALKBH7 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cow -
Immunogen
Recombinant fragment corresponding to Human ALKBH7 aa 21-92.
Sequence:SGPSVLSRLQDAAVVRPGFLSTAEEETLSRELEPELRRRRYEYDHWDAAI HGFRETEKSRWSEASRAILQRV
Database link: Q9BT30 -
Positive control
- Human kidney tissue; LY403154 cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab204568 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 25 kDa. |
Target
-
Function
Probable dioxygenase that requires molecular oxygen, alpha-ketoglutarate and iron. -
Tissue specificity
Widely expressed, with highest expression in pancreas, followed by spleen, prostate, ovary and placenta. -
Sequence similarities
Belongs to the alkB family. -
Cellular localization
Cytoplasm. Nucleus. Secreted. Has a predicted N-terminal signal sequence, indicating it may be secreted. Detected in cytoplasm and nucleus when expressed as fusion protein with an N-terminal tag. - Information by UniProt
-
Database links
- Entrez Gene: 84266 Human
- Omim: 613305 Human
- SwissProt: Q2M2S8 Cow
- SwissProt: Q9BT30 Human
- Unigene: 111099 Human
-
Alternative names
- ABH7 antibody
- ALKB7_HUMAN antibody
- ALKBH7 antibody
see all
Images
-
All lanes : Anti-ALKBH7 antibody (ab204568) at 1/100 dilution
Lane 1 : Negative Control
Lane 2 : overexpression cell lysate
Predicted band size: 25 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ALKBH7 antibody (ab204568)
Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling ALKBH7 with ab204568 at 1/50 dilution.
Protocols
Datasheets and documents
References (0)
ab204568 has not yet been referenced specifically in any publications.