Overview

  • Product name
  • Description
    Rabbit polyclonal to ALKBH8
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human ALKBH8 aa 27-106.
    Sequence:

    HTLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLM PPNKPYSFARYRTTEESKRAYVTLNGKEVV


    Database link: Q96BT7

  • Positive control
    • Human pancreas tissue; U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204742 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function
    Catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA. Catalyzes the last step in the formation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA. Has a preference for tRNA(Arg) and tRNA(Glu), and does not bind tRNA(Lys). Required for normal survival after DNA damage. May inhibit apoptosis and promote cell survival and angiogenesis.
  • Tissue specificity
    Widely expressed, with highest expression in spleen, followed by pancreas and lung.
  • Sequence similarities
    Belongs to the alkB family.
    Contains 1 Fe2OG dioxygenase domain.
    Contains 1 RRM (RNA recognition motif) domain.
  • Cellular localization
    Cytoplasm. Nucleus. Predominantly cytoplasmic.
  • Information by UniProt
  • Database links
  • Alternative names
    • 4930562C03Rik antibody
    • 8030431D03Rik antibody
    • 9430088N01Rik antibody
    • ABH8 antibody
    • alkB alkylation repair homolog 8 (E. coli) antibody
    • alkB alkylation repair homolog 8 antibody
    • AlkB homologue 8 antibody
    • ALKB8_HUMAN antibody
    • ALKBH8 antibody
    • Alkylated DNA repair protein alkB homolog 8 antibody
    • FLJ38204 antibody
    • MGC10235 antibody
    • OTTHUMP00000211286 antibody
    • OTTHUMP00000211287 antibody
    • Probable alpha-ketoglutarate-dependent dioxygenase ABH8 antibody
    • RGD1304687 antibody
    • S-adenosyl-L-methionine-dependent tRNA methyltransferase ABH8 antibody
    • tRNA (carboxymethyluridine(34)-5-O)-methyltransferase ABH8 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human pancreas tissue labeling ALKBH8 with ab204742 at 1/50 dilution.

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling ALKBH8 with ab204742 at 4 µg/ml (green).

References

ab204742 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204742.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up