Overview

  • Product name
    Anti-Alpha 1 Acid Glycoprotein/AGP antibody [C1]
    See all Alpha 1 Acid Glycoprotein/AGP primary antibodies
  • Description
    Mouse monoclonal [C1] to Alpha 1 Acid Glycoprotein/AGP
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Rat, Pig
  • Immunogen

    Recombinant fragment corresponding to Rat Alpha 1 Acid Glycoprotein/AGP aa 19-186. Two N-terminal tags, His-tag and GST-tag. (Expressed in E.coli).
    Sequence:

    QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYF YLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFA HLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGM DESEIVFVDWTKDKCSEQ


    Database link: P02764

  • Positive control
    • WB: Rat brain, cerebellum, liver and testis lysates; Pig brain lysate; Recombinant rat Alpha 1 Acid Glycoprotein/AGP protein. IHC-P: Rat liver, adrenal gland, stomach and heart tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab239473 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 24 kDa.
IHC-P Use a concentration of 5 - 30 µg/ml.

Target

  • Function
    Appears to function in modulating the activity of the immune system during the acute-phase reaction.
  • Tissue specificity
    Expressed by the liver and secreted in plasma.
  • Sequence similarities
    Belongs to the calycin superfamily. Lipocalin family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • A1AG1_HUMAN antibody
    • AGP 1 antibody
    • AGP A antibody
    • AGP antibody
    • AGP1 antibody
    • Alpha 1 acid glycoprotein antibody
    • Alpha-1-acid glycoprotein 1 antibody
    • alpha-1-AGP antibody
    • Epididymis secretory sperm binding protein Li 153w antibody
    • glycoprotein, alpha-1-acid, of serum antibody
    • HEL S 153w antibody
    • OMD 1 antibody
    • ORM antibody
    • ORM1 antibody
    • Orosomucoid 1 antibody
    • Orosomucoid-1 antibody
    see all

Images

  • Paraffin-embedded rat liver tissue stained for Alpha 1 Acid Glycoprotein/AGP using ab239473 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Alpha 1 Acid Glycoprotein/AGP antibody [C1] (ab239473) at 2 µg/ml + Recombinant rat Alpha 1 Acid Glycoprotein/AGP protein

    Secondary
    HRP Linked Rabbit Anti-Mouse IgG at 1/5000 dilution

    Predicted band size: 24 kDa

  • Paraffin-embedded rat adrenal gland tissue stained for Alpha 1 Acid Glycoprotein/AGP using ab239473 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat stomach tissue stained for Alpha 1 Acid Glycoprotein/AGP using ab239473 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-Alpha 1 Acid Glycoprotein/AGP antibody [C1] (ab239473) at 2 µg/ml

    Lane 1 : Rat brain lysate
    Lane 2 : Rat cerebellum lysate
    Lane 3 : Pig brain lysate

    Secondary
    All lanes : HRP Linked Rabbit Anti-Mouse IgG at 1/5000 dilution

    Predicted band size: 24 kDa

  • Paraffin-embedded rat heart tissue stained for Alpha 1 Acid Glycoprotein/AGP using ab239473 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Alpha 1 Acid Glycoprotein/AGP antibody [C1] (ab239473) at 2 µg/ml + Rat liver lysate

    Predicted band size: 24 kDa

  • Anti-Alpha 1 Acid Glycoprotein/AGP antibody [C1] (ab239473) at 2 µg/ml + Rat testis lysate

    Predicted band size: 24 kDa

References

ab239473 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239473.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up