Anti-alpha 1 Fetoprotein antibody (ab231264)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-alpha 1 Fetoprotein antibody
See all alpha 1 Fetoprotein primary antibodies -
Description
Rabbit polyclonal to alpha 1 Fetoprotein -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Dog -
Immunogen
Recombinant fragment (His-tag) corresponding to Dog alpha 1 Fetoprotein aa 234-380. N-terminal tag. Expressed in E. coli.
Sequence:TFRAITVTKLSQKFSKANFTEIQKLVLDVAHIHEECCRGNVLECLQDGEK IMSYICSQQDILSSKIADCCKLPILELGQCIIHAENDGKPEGLSPNLNRF LEERDFNQFSSREKDLFMARFTYEYSRRHTKLAVPVVLRVAKGYQEL
Database link: Q8MJU5 -
Positive control
- WB: Recombinant canine alpha 1 Fetoprotein protein. Canine serum. Canine cerebrum lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Protein A purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231264 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.2 - 2 µg/ml. |
Target
-
Function
Binds copper, nickel, and fatty acids as well as, and bilirubin less well than, serum albumin. Only a small percentage (less than 2%) of the human AFP shows estrogen-binding properties. -
Tissue specificity
Plasma. Synthesized by the fetal liver and yolk sac. -
Sequence similarities
Belongs to the ALB/AFP/VDB family.
Contains 3 albumin domains. -
Developmental stage
Occurs in the plasma of fetuses more than 4 weeks old, reaches the highest levels during the 12th-16th week of gestation, and drops to trace amounts after birth. The serum level in adults is usually less than 40 ng/ml. AFP occurs also at high levels in the plasma and ascitic fluid of adults with hepatoma. -
Post-translational
modificationsIndependent studies suggest heterogeneity of the N-terminal sequence of the mature protein and of the cleavage site of the signal sequence.
Sulfated. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 403551 Dog
- SwissProt: Q8MJU5 Dog
-
Alternative names
- Afp antibody
- AFPD antibody
- Alpha fetoglobulin antibody
see all
Images
-
Western blot - Anti-alpha 1 Fetoprotein antibody (ab231264)Anti-alpha 1 Fetoprotein antibody (ab231264) at 5 µg/ml + Canine serum. -
Western blot - Anti-alpha 1 Fetoprotein antibody (ab231264)Anti-alpha 1 Fetoprotein antibody (ab231264) at 2 µg/ml + Canine cerebrum lysate. -
Western blot - Anti-alpha 1 Fetoprotein antibody (ab231264)Anti-alpha 1 Fetoprotein antibody (ab231264) at 2 µg/ml + Recombinant canine alpha 1 Fetoprotein protein.
Datasheets and documents
References
ab231264 has not yet been referenced specifically in any publications.
