Anti-alpha 1 Fetoprotein antibody (ab231264)
Key features and details
- Rabbit polyclonal to alpha 1 Fetoprotein
- Suitable for: WB
- Reacts with: Dog
- Isotype: IgG
Overview
-
Product name
Anti-alpha 1 Fetoprotein antibody
See all alpha 1 Fetoprotein primary antibodies -
Description
Rabbit polyclonal to alpha 1 Fetoprotein -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Dog -
Immunogen
Recombinant fragment (His-tag) corresponding to Dog alpha 1 Fetoprotein aa 234-380. N-terminal tag. Expressed in E. coli.
Sequence:TFRAITVTKLSQKFSKANFTEIQKLVLDVAHIHEECCRGNVLECLQDGEK IMSYICSQQDILSSKIADCCKLPILELGQCIIHAENDGKPEGLSPNLNRF LEERDFNQFSSREKDLFMARFTYEYSRRHTKLAVPVVLRVAKGYQEL
Database link: Q8MJU5 -
Positive control
- WB: Recombinant canine alpha 1 Fetoprotein protein. Canine serum. Canine cerebrum lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231264 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.2 - 2 µg/ml. |
Target
-
Function
Binds copper, nickel, and fatty acids as well as, and bilirubin less well than, serum albumin. Only a small percentage (less than 2%) of the human AFP shows estrogen-binding properties. -
Tissue specificity
Plasma. Synthesized by the fetal liver and yolk sac. -
Sequence similarities
Belongs to the ALB/AFP/VDB family.
Contains 3 albumin domains. -
Developmental stage
Occurs in the plasma of fetuses more than 4 weeks old, reaches the highest levels during the 12th-16th week of gestation, and drops to trace amounts after birth. The serum level in adults is usually less than 40 ng/ml. AFP occurs also at high levels in the plasma and ascitic fluid of adults with hepatoma. -
Post-translational
modificationsIndependent studies suggest heterogeneity of the N-terminal sequence of the mature protein and of the cleavage site of the signal sequence.
Sulfated. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 403551 Dog
- SwissProt: Q8MJU5 Dog
-
Alternative names
- Afp antibody
- AFPD antibody
- Alpha fetoglobulin antibody
see all
Images
-
Anti-alpha 1 Fetoprotein antibody (ab231264) at 5 µg/ml + Canine serum.
-
Anti-alpha 1 Fetoprotein antibody (ab231264) at 2 µg/ml + Canine cerebrum lysate.
-
Anti-alpha 1 Fetoprotein antibody (ab231264) at 2 µg/ml + Recombinant canine alpha 1 Fetoprotein protein.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231264 has not yet been referenced specifically in any publications.